Recombinant Arabidopsis thaliana Reticulon-like protein B7 (RTNLB7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. To ensure a particular tag type, please specify your requirements; we will prioritize fulfilling your request.
Synonyms
RTNLB7; At4g01230; F2N1.8; Reticulon-like protein B7; AtRTNLB7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB7
Target Protein Sequence
MEEEKLEIVGPLEEPLMGNIVPEEINGLDSLTSSDSDSEKPDSPVPINAPIYRMFGRERP IHMVLGGGKPADVLLWRDKKVTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLLSFL WSNALNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMAVIGLW LVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEIDPIAEKAVIEMKKHYQVFEAKFLS KIPH
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is RTNLB7 and how does it relate to other reticulon proteins in Arabidopsis?

RTNLB7 belongs to the reticulon-like protein family in Arabidopsis thaliana, which consists of 21 members (RTNLB1-21). Like other reticulons, RTNLB7 contains a conserved reticulon homology domain (RHD) with two long hydrophobic regions that form transmembrane domains. While specific functions of RTNLB7 are still being elucidated, other family members such as RTNLB1-4 and RTNLB13 have been well-characterized for their roles in ER tubulation and membrane shaping . Studies have shown that RTNLB1, RTNLB2, and RTNLB4 interact with Agrobacterium tumefaciens VirB2 protein and participate in Agrobacterium infection processes, providing a model for understanding potential roles of RTNLB7 in plant-microbe interactions.

Why is recombinant expression of RTNLB7 important for plant research?

Recombinant expression of RTNLB7 provides researchers with sufficient protein quantities for biochemical and structural studies that would otherwise be difficult to achieve from native expression systems. Purified recombinant RTNLB7 enables detailed investigations of protein-protein interactions, potential roles in membrane remodeling, and functional relationships with other reticulon family members. Additionally, recombinant RTNLB7 can be tagged with epitopes such as T7, similar to approaches used with RTNLB4, facilitating protein detection and localization studies in both in vitro assays and transgenic plants .

What expression systems are most effective for producing recombinant RTNLB7?

For recombinant RTNLB7 production, several expression systems have proven effective, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, inclusion body formation2-5
Insect cellsBetter protein folding, appropriate post-translational modificationsHigher cost, longer production time1-3
Plant expression systemsNative folding environment, authentic modificationsLower yield, time-consuming0.5-1

When using E. coli, expression is typically optimized using specialized strains like BL21(DE3) containing membrane protein expression enhancers. For membrane proteins like RTNLB7, induction with lower IPTG concentrations (0.1-0.5 mM) at reduced temperatures (18-20°C) generally improves proper folding. Similar approaches have been successfully used for other Arabidopsis reticulon proteins.

How can researchers confirm the proper expression and folding of recombinant RTNLB7?

Proper expression and folding of recombinant RTNLB7 can be confirmed through multiple complementary approaches:

  • Western blot analysis using antibodies against RTNLB7 or epitope tags (like T7-tag) can confirm expression and molecular weight. For membrane proteins like reticulons, sample preparation should include appropriate detergents to prevent aggregation during electrophoresis.

  • Circular dichroism (CD) spectroscopy provides information about secondary structure content, which can be compared to structural predictions or data from other characterized reticulon proteins.

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) helps assess oligomeric state and homogeneity of the purified protein.

  • Functional assays examining membrane binding or tubulation abilities using artificial liposomes can verify that the recombinant protein retains its native activities.

What purification strategies yield highest purity and functionality for recombinant RTNLB7?

Purification of recombinant RTNLB7 requires specialized approaches due to its membrane protein nature. The following stepwise protocol has proven effective:

  • Membrane extraction: Solubilize cell membranes using mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or LDAO at 1% concentration in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and 5% glycerol.

  • Initial purification: If using tagged proteins (His6-RTNLB7), perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resin with gradual imidazole elution (20-300 mM).

  • Secondary purification: Apply size exclusion chromatography using Superdex 200 in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and reduced detergent concentration (0.03-0.05% DDM).

  • Quality assessment: Verify purity by SDS-PAGE (>95%) and functionality through liposome binding assays or in vitro ER tubulation assays.

This approach typically yields 1-2 mg of pure, functional protein per liter of bacterial culture, sufficient for most biochemical and structural studies.

How can researchers study RTNLB7 interactions with other proteins in vitro?

Several complementary techniques can be employed to study RTNLB7 interactions with other proteins:

  • Co-immunoprecipitation: Using epitope-tagged RTNLB7 (similar to T7-tagged RTNLB4 approaches ), researchers can identify interacting partners by mass spectrometry following co-immunoprecipitation from plant extracts.

  • Bimolecular Fluorescence Complementation (BiFC): This approach can confirm direct protein-protein interactions in planta, similar to techniques used to demonstrate interactions between NLP2 and NLP7 transcription factors . Split YFP fragments fused to RTNLB7 and potential interacting partners will reconstitute fluorescence when proteins interact.

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics, purified RTNLB7 can be immobilized on a sensor chip surface, and potential binding partners flowed over to measure association and dissociation rates.

  • Isothermal Titration Calorimetry (ITC): This technique provides thermodynamic parameters of binding interactions between RTNLB7 and partner proteins, yielding binding affinity, stoichiometry, and entropy/enthalpy contributions.

What phenotypic analysis methods are most informative for studying RTNLB7 function?

Comprehensive phenotypic analysis of RTNLB7 function requires multiple approaches:

  • Gene expression analysis:

    • RT-qPCR to quantify RTNLB7 expression across tissues and conditions, similar to approaches used for RTNLB4

    • RNA-seq to identify genome-wide transcriptional changes in rtnlb7 mutants compared to wild-type

  • Microscopy-based analysis:

    • Confocal microscopy of fluorescently-tagged RTNLB7 to study subcellular localization and dynamics

    • Transmission electron microscopy to examine ER morphology changes in rtnlb7 mutants or overexpression lines

  • Physiological phenotyping:

    • Growth analysis under various stresses (drought, salt, pathogen exposure)

    • Root development assays, particularly examining root hair formation (given reticulon involvement with ROOT HAIR DEFECTIVE3 )

  • Biochemical characterization:

    • Membrane fraction analysis to quantify ER morphology changes

    • Lipid profiling to identify alterations in membrane composition

How can researchers generate and validate RTNLB7 knockout or overexpression lines?

Creating and validating genetic resources for RTNLB7 functional studies requires:

  • Knockout line generation:

    • T-DNA insertion lines from repositories (SALK, SAIL, GABI-Kat)

    • CRISPR-Cas9 genome editing targeting RTNLB7 exons

    • Confirmation of knockout by RT-qPCR showing reduction in transcript levels (similar to validation of rtnlb4 mutants showing 13.3-23.3% of wild-type expression )

  • Overexpression line creation:

    • Cloning RTNLB7 coding sequence under strong promoters (e.g., CaMV 35S)

    • Adding epitope tags for detection (T7-tag or fluorescent proteins)

    • Selection of multiple independent transformation events

    • Verification by RT-qPCR and western blot (similar to RTNLB4 overexpression validation )

  • Complementation assays:

    • Introducing wild-type RTNLB7 into knockout lines to confirm phenotype rescue

    • Testing structure-function relationships with modified RTNLB7 variants

How does RTNLB7 contribute to plant responses to pathogens?

While specific information about RTNLB7's role in pathogen response is limited, research on related reticulon proteins provides a framework for investigation:

  • Several Arabidopsis reticulons, including RTNLB1, RTNLB2, and RTNLB4, interact with Agrobacterium tumefaciens VirB2 protein and influence infection efficiency . Knockout of RTNLB4 significantly reduced tumor formation in Agrobacterium-mediated transformation assays, while overexpression enhanced transformation efficiency.

  • The expression of RTNLB4 is induced by pathogen-associated molecular patterns (PAMPs) such as elf18, with significant upregulation occurring within 10 minutes of exposure and continuing to increase over 6 hours . This suggests a potential role for reticulons in PAMP-triggered immunity.

  • Research approaches to elucidate RTNLB7's role could include:

    • Measuring susceptibility of rtnlb7 mutants to various pathogens

    • Analyzing RTNLB7 expression in response to PAMPs and effectors

    • Identifying RTNLB7 interactions with known immune receptors and signaling components

What is the role of RTNLB7 in endoplasmic reticulum morphology regulation?

Reticulon proteins are primarily known for their function in shaping the tubular ER network. For RTNLB7, researchers should investigate:

  • ER morphology visualization: Using fluorescent ER markers in rtnlb7 mutants and overexpression lines to quantify changes in ER tubulation, cisternae formation, and three-way junctions.

  • Membrane curvature mechanisms: RTNLB7 likely contains wedge-shaped transmembrane domains that insert into the outer leaflet of the ER membrane to induce curvature. Mutational analysis of these domains can reveal structure-function relationships.

  • Interactions with other ER-shaping proteins: Potential interactions with other members of the reticulon family, atlastins, or ROOT HAIR DEFECTIVE3 would indicate cooperative networks in ER morphology regulation .

  • Dynamic regulation: Live-cell imaging of fluorescently-tagged RTNLB7 can reveal the protein's mobility and response to cellular stresses that induce ER remodeling.

How does RTNLB7 coordinate with transcription factors to influence plant development?

Recent research on plant transcription factors and their interactions with membrane proteins suggests potential connections between RTNLB7 and transcriptional networks:

  • The NIN-LIKE PROTEIN (NLP) transcription factors, particularly NLP2 and NLP7, regulate nitrate-responsive genes and influence plant growth . The nuclear localization of these factors is controlled by nitrate signaling and involves interactions with membrane-associated proteins.

  • Research questions to explore RTNLB7-transcription factor connections include:

    • Whether RTNLB7 expression is regulated by specific transcription factors

    • If RTNLB7 influences the nuclear transport or activity of transcription factors

    • Whether RTNLB7 and transcription factors like NLPs share common target genes or processes

  • Methodological approaches could include:

    • ChIP-seq to identify transcription factors binding to the RTNLB7 promoter

    • RNA-seq comparing transcriptomes of rtnlb7 mutants and transcription factor mutants

    • Protein-protein interaction studies to detect direct associations

What computational tools best predict RTNLB7 structure and interactions?

Modern computational approaches provide valuable insights for RTNLB7 research:

  • Protein structure prediction:

    • AlphaFold2 and RoseTTAFold can generate reliable structural models of RTNLB7, particularly for the conserved reticulon homology domain

    • Molecular dynamics simulations can predict how RTNLB7 interacts with lipid bilayers

  • Protein-protein interaction prediction:

    • Tools like STRING, IntAct, and PrePPI can identify potential interaction partners

    • Molecular docking simulations can model specific binding interfaces

  • Evolutionary analysis:

    • Sequence conservation analysis across plant species can identify functionally critical regions

    • Coevolution analysis can predict residues involved in protein-protein interactions

  • Expression data mining:

    • Tools that integrate transcriptomic datasets can reveal conditions where RTNLB7 is co-regulated with other genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.