Recombinant Arabidopsis thaliana Reticulon-like protein B8 (RTNLB8)

Shipped with Ice Packs
In Stock

Description

What is Recombinant Arabidopsis thaliana Reticulon-like protein B8 (RTNLB8)?

Recombinant Arabidopsis thaliana Reticulon-like protein B8 (RTNLB8) is a protein derived from the plant Arabidopsis thaliana, also known as mouse-ear cress . It belongs to the reticulon-like protein family . RTNLB8 is involved in various cellular processes, including the modulation of susceptibility to bacterial infections and participation in endoplasmic reticulum (ER) modeling .

Characteristics of RTNLB8

  • Source Species Arabidopsis thaliana

  • Product Type Recombinant Protein

  • UniProt ID Q9SS37

  • Tag Information Determined during the production process

  • Storage Buffer Tris-based buffer with 50% glycerol

  • Amino Acid Sequence MPDKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFDRQKPIHHVLGGGKSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGKFGLKKRE

  • Protein Name Reticulon-like protein B8, short name AtRTNLB8

  • Gene Name RTNLB8, Ordered Locus Name: At3g10260, ORF Names: F14P13.14

  • Expression Region Amino acids 1-247

  • Sequence Info Full length protein

Interactions with Other Proteins

RTNLB8 interacts with other RTNLB proteins, such as RTNLB2 and RTNLB4, suggesting its role in ER modeling . It also interacts with the Agrobacterium tumefaciens VirB2 protein, influencing the bacterial infection process .

Bait ProteinPrey ProteinInteraction
RTNLB2RTNLB3, RTNLB8Yes
RTNLB3RTNLB2, RTNLB4, RTNLB8Yes
RTNLB4RTNLB8Yes
RTNLB5, 6, 7, 8RTNLB1-8No
RTNLB1RTNLB3, RTNLB5-8No

Role in Agrobacterium tumefaciens Infection

Genetic studies have indicated that rtnlb8 mutants show recalcitrance in Agrobacterium tumefaciens-mediated transient transformation assays . Overexpression of RTNLB8 enhances the susceptibility of transgenic plant root tissue to A. tumefaciens, suggesting its involvement in the infection process .

Impact on P. syringae Infection

Overexpression of RTNLB8 in transgenic plants leads to enhanced susceptibility to P. syringae DC3000 infection, with increased bacterial numbers and more severe disease symptoms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RTNLB8; At3g10260; F14P13.14; Reticulon-like protein B8; AtRTNLB8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB8
Target Protein Sequence
MPDKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFDRQKPIHHVLGGGK SADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLN RSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVG SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGK FGLKKRE
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G10260

STRING: 3702.AT3G10260.3

UniGene: At.21990

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Reticulon-like protein B8 (RTNLB8)?

RTNLB8 is a member of the reticulon-like protein family in Arabidopsis thaliana. It belongs to the Group I RTNLB proteins (RTNLB1-8) which contain an N-terminal domain with 43-93 amino acid residues and a short C-terminal domain . Like other reticulon proteins, RTNLB8 contains a carboxyl-terminal reticulon (RTN) homology domain composed of two large hydrophobic regions with a ~66 amino acid loop between them . RTNLB8 is a membrane protein primarily localized in the plant endomembrane systems and has been implicated in various plant-microbe interactions, particularly during Agrobacterium tumefaciens infection processes .

What is the expression pattern of RTNLB8 in different plant tissues?

Real-time PCR analysis has revealed that RTNLB8 expression varies across different Arabidopsis tissues. The highest expression levels of RTNLB8 have been detected in flowers, with relatively lower expression in roots, rosette leaves, cauline leaves, inflorescence, and siliques . This tissue-specific expression pattern differs somewhat from predictions made using the Arabidopsis eFP browser, which suggested highest abundance in cauline and rosette leaves . This discrepancy might be attributed to differences in analysis methods and plant growth stages used in different studies, highlighting the importance of experimental validation when characterizing gene expression patterns .

How does RTNLB8 function in Agrobacterium-mediated plant transformation?

RTNLB8 plays a critical role in facilitating Agrobacterium-mediated transformation of plant cells. Experimental evidence shows that rtnlb8 mutant plants exhibit significant resistance to A. tumefaciens infection . In transient transformation assays using Arabidopsis seedlings, rtnlb8 mutants showed 67% to 84% decrease in transformation efficiency compared to wild-type plants . Conversely, overexpression of RTNLB8 in transgenic plants enhanced both stable and transient transformation rates by 1.3- to 2.0-fold compared with wild-type plants . These findings suggest that RTNLB8 participates in the early steps of A. tumefaciens-mediated transformation, before T-DNA integration into the plant genome .

What protein interactions has RTNLB8 been shown to form?

RTNLB8 forms specific protein-protein interactions that may be crucial for its biological functions. Both yeast two-hybrid and GST pull-down assays have demonstrated that RTNLB8 interacts with:

  • VirB2 protein, the major component of A. tumefaciens T-pilus

  • Other RTNLB family members, specifically RTNLB2, RTNLB3, and RTNLB4

Interestingly, more positive interactions of RTNLB8 with VirB2 and other RTNLB proteins were detected in GST pull-down assays than in yeast two-hybrid assays . This discrepancy may be due to differences in protein conformation between the assay systems compared to native conditions in plant cells .

What experimental approaches are most effective for studying RTNLB8-VirB2 interactions?

For studying RTNLB8-VirB2 interactions, researchers should consider multiple complementary approaches to ensure robust results. In vitro GST pull-down assays have proven more effective than yeast two-hybrid systems for detecting RTNLB8-VirB2 interactions . The protocol involves:

  • Expressing GST-tagged RTNLB8 in E. coli and purifying it using glutathione-agarose beads

  • Incubating the purified protein with in vitro translated 35S-labeled VirB2

  • Washing the beads and analyzing bound proteins by SDS-PAGE and autoradiography

For in vivo validation, bimolecular fluorescence complementation (BiFC) in plant cells provides spatial information about where these interactions occur within the cell. Co-immunoprecipitation from plant tissues expressing tagged versions of both proteins can further confirm the physiological relevance of these interactions. Surface plasmon resonance or isothermal titration calorimetry could provide quantitative binding parameters that characterize the strength and kinetics of RTNLB8-VirB2 interactions.

How can researchers generate and characterize rtnlb8 mutants effectively?

Generation and characterization of rtnlb8 mutants requires a systematic approach:

  • Mutant identification: T-DNA insertion lines for RTNLB8 can be obtained from stock centers like ABRC (Arabidopsis Biological Resource Center). The study used two independent T-DNA insertion lines (rtnlb8-1 and rtnlb8-2) .

  • Verification of insertion: Use PCR-based genotyping with gene-specific primers and T-DNA border primers to confirm the presence and location of the insertion.

  • Expression analysis: Perform RT-PCR and real-time PCR to verify reduced RTNLB8 transcript levels. This is critical to confirm the knockout or knockdown status of the mutant .

  • Phenotypic characterization:

    • Perform root-based A. tumefaciens transformation assays to assess stable transformation efficiency

    • Use seedling-based transient transformation assays with GUS reporter genes to quantify transformation efficiency

    • Test susceptibility to bacterial pathogens like Pseudomonas syringae

  • Complementation analysis: Transform rtnlb8 mutants with wild-type RTNLB8 gene to confirm that observed phenotypes are specifically due to the loss of RTNLB8 function.

What methods are appropriate for investigating RTNLB8's role in endomembrane trafficking?

To investigate RTNLB8's role in endomembrane trafficking, researchers should employ a combination of cell biology, biochemistry, and genetics approaches:

  • Subcellular localization: Generate transgenic plants expressing fluorescently-tagged RTNLB8 (e.g., RTNLB8-GFP) and use confocal microscopy to determine its precise localization within the endomembrane system .

  • Co-localization studies: Combine RTNLB8-GFP with markers for different endomembrane compartments (ER, Golgi, endosomes) to identify which compartments RTNLB8 associates with.

  • Membrane topology analysis: Use protease protection assays or split-GFP approaches to determine the orientation of RTNLB8 in membranes.

  • Protein trafficking assays: Monitor the movement of defense-related receptors (like EFR or FLS2) in wild-type versus rtnlb8 mutant backgrounds using pulse-chase experiments with fluorescently-tagged receptors .

  • ER morphology analysis: Since RTNLBs are involved in ER tubular structure formation, compare ER morphology in wild-type and rtnlb8 mutant plants using ER-targeted fluorescent markers .

  • Electron microscopy: Use transmission electron microscopy to examine ultrastructural changes in endomembrane organization in rtnlb8 mutants.

How does RTNLB8 overexpression affect plant susceptibility to different bacterial pathogens?

RTNLB8 overexpression significantly alters plant responses to bacterial pathogens. Research has shown:

  • Enhanced susceptibility to A. tumefaciens: RTNLB8-overexpressing plants show 1.3- to 2.0-fold higher transformation rates in both stable and transient transformation assays compared to wild-type plants .

  • Increased susceptibility to Pseudomonas syringae: Plants overexpressing RTNLB8 exhibit hypersusceptibility to P. syringae infection .

The dual effect on both bacterial species suggests RTNLB8 may influence general aspects of plant-microbe interactions rather than pathogen-specific mechanisms. To investigate this phenomenon, researchers should:

  • Test susceptibility to a broader range of pathogens (bacterial, fungal, viral)

  • Measure expression of defense-related genes using qRT-PCR

  • Quantify defense hormone levels (salicylic acid, jasmonic acid)

  • Analyze activation patterns of defense-related MAPKs

  • Examine receptor trafficking in overexpression lines, particularly pattern recognition receptors like EFR and FLS2 that are crucial for bacterial recognition

A comparative analysis between RTNLB8 and other RTNLB overexpression lines (such as RTNLB1-4) would help determine if these susceptibility phenotypes represent a common feature of RTNLB proteins or are specific to RTNLB8.

What experimental design best reveals the specific mechanisms by which RTNLB8 affects Agrobacterium-mediated transformation?

To elucidate the specific mechanisms by which RTNLB8 affects A. tumefaciens transformation, a multi-faceted experimental approach is required:

  • Temporal analysis: Examine the effects of RTNLB8 at different stages of transformation by using:

    • Bacterial attachment assays to assess if RTNLB8 affects initial contact

    • T-DNA transfer monitoring using fluorescently-labeled DNA

    • T-complex trafficking assays to track VirE2-T-strand complexes

    • Integration assays to measure nuclear import and T-DNA integration

  • Structure-function analysis: Generate truncated or mutated versions of RTNLB8 to identify domains critical for:

    • VirB2 interaction

    • Interaction with other RTNLB proteins

    • Membrane localization

    • Enhancement of transformation efficiency

  • Comparative analysis with other RTNLBs: Create RTNLB8/RTNLB3 or RTNLB8/RTNLB1 double mutants to assess potential functional redundancy or synergistic effects .

  • Identification of plant targets: Perform co-immunoprecipitation coupled with mass spectrometry to identify additional plant proteins that interact with RTNLB8 during A. tumefaciens infection.

  • Time-course expression analysis: Monitor RTNLB8 expression at various timepoints after A. tumefaciens infection to determine if its expression changes in response to bacterial contact, similar to the transient increase observed for RTNLB1 .

What are the challenges in purifying recombinant RTNLB8 protein for in vitro studies?

Purification of recombinant RTNLB8 presents several technical challenges due to its nature as a membrane protein with hydrophobic domains. Researchers should consider:

  • Expression system selection: E. coli systems may result in inclusion bodies due to the hydrophobic nature of RTNLB8. Alternative expression systems to consider include:

    • Insect cell expression systems (baculovirus)

    • Cell-free protein synthesis systems

    • Yeast expression systems optimized for membrane proteins

  • Solubilization strategies:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Test detergent-free approaches using styrene-maleic acid copolymer (SMA) that can extract proteins with their native lipid environment

    • Consider nanodiscs for maintaining protein structure and function after purification

  • Fusion tag optimization:

    • Test different fusion tags beyond GST, such as MBP (maltose-binding protein) which can enhance solubility

    • Use cleavable tags with precision proteases to obtain native protein

    • Position tags at either N- or C-terminus to determine optimal configuration for folding and activity

  • Functional validation: Confirm that purified RTNLB8 retains its ability to interact with known partners like VirB2 using in vitro binding assays .

How can researchers differentiate between the functions of different RTNLB family members?

Differentiating the specific functions of RTNLB family members requires systematic comparative analysis:

  • Expression pattern comparison: Perform side-by-side analysis of expression patterns across tissues and developmental stages for all RTNLB proteins using:

    • qRT-PCR for transcript profiling

    • Promoter-reporter fusions to visualize spatial expression patterns

    • Western blotting with specific antibodies to quantify protein levels

  • Higher-order mutant analysis: Generate and characterize:

    • Single mutants for each RTNLB

    • Double, triple, or higher-order mutants of phylogenetically related RTNLBs

    • CRISPR/Cas9-mediated knockouts for genes lacking T-DNA insertions

  • Protein interaction network mapping:

    • Perform systematic yeast two-hybrid or BiFC screens to compare interaction partners

    • Use quantitative proteomics to identify unique and shared interactors

    • Compare VirB2 binding affinities among different RTNLBs using surface plasmon resonance

  • Domain swap experiments: Create chimeric proteins by swapping domains between different RTNLB proteins to identify regions responsible for specific functions or interactions.

  • Response to biotic stresses: Compare the susceptibility phenotypes of different RTNLB mutants and overexpression lines to:

    • A. tumefaciens (transient and stable transformation)

    • P. syringae and other bacterial pathogens

    • Fungal pathogens and herbivores

The data from these comparative analyses can be organized into a comprehensive table showing functional similarities and differences among RTNLB family members.

What techniques can be used to analyze RTNLB8 membrane topology and dynamics?

Understanding RTNLB8 membrane topology and dynamics requires specialized techniques:

  • Membrane topology mapping:

    • Protease protection assays to determine which domains are exposed to cytosol vs. lumen

    • Glycosylation site mapping with engineered N-glycosylation sites

    • Fluorescence protease protection (FPP) assay with GFP-tagged RTNLB8

    • Cysteine scanning mutagenesis combined with membrane-impermeable thiol-reactive reagents

  • Lateral mobility analysis:

    • Fluorescence recovery after photobleaching (FRAP) to measure diffusion rates in membranes

    • Single particle tracking of fluorescently-tagged RTNLB8

    • Fluorescence correlation spectroscopy (FCS) to analyze molecular dynamics

  • Membrane domain association:

    • Detergent-resistant membrane isolation to assess lipid raft association

    • Förster resonance energy transfer (FRET) with lipid domain markers

    • Super-resolution microscopy (STORM, PALM) to visualize nanoscale distribution

  • Structural studies:

    • Circular dichroism spectroscopy to analyze secondary structure in membrane mimetics

    • Hydrogen-deuterium exchange mass spectrometry to identify membrane-protected regions

    • Cryo-electron microscopy of RTNLB8 in nanodiscs or liposomes

  • Dynamic association with membrane-shaping machinery:

    • Live-cell imaging with markers for ER tubulation machinery

    • Co-immunoprecipitation with known membrane curvature-inducing proteins

    • In vitro membrane deformation assays with purified components

What are optimal conditions for studying RTNLB8 involvement in Agrobacterium-mediated transformation?

For studying RTNLB8's role in Agrobacterium-mediated transformation, researchers should consider these optimized experimental conditions:

  • Bacterial concentration optimization:

    • Use bacterial concentrations between 10^5 and 10^6 cfu·mL^-1 for transformation assays, as these concentrations revealed the most significant differences between wild-type and RTNLB8 overexpression plants

    • Perform transformation assays with a concentration series to identify the most sensitive range for detecting RTNLB8-dependent effects

  • Tissue selection:

    • Seedling-based transformation assays showed greater sensitivity in detecting transformation differences in rtnlb3 and rtnlb8 mutants compared to root-based assays

    • Different tissues show varying susceptibility to A. tumefaciens infection, so multiple tissue types should be tested

  • Transformation assay optimization:

    • For transient transformation, use GUS reporter assays with quantitative MUG (4-methylumbelliferyl β-D-glucuronide) fluorometric measurement for precise quantification

    • For stable transformation, optimize tumor formation assays by adjusting co-cultivation time and temperature

  • Genetic background considerations:

    • Generate multiple independent transgenic lines with varying RTNLB8 expression levels

    • Include T7-tagged versions of RTNLB8 to facilitate protein detection and immunoprecipitation

    • Use the same ecotype (Columbia) for all comparisons to minimize genetic background effects

  • Environmental conditions:

    • Control temperature, light, and humidity precisely during transformation assays

    • Document plant age and growth stage, as these factors influence transformation efficiency

  • Controls and normalizations:

    • Include both positive controls (wild-type plants) and negative controls (known transformation-resistant mutants)

    • Normalize transformation efficiency data to account for variations in plant size or tissue amount

How might RTNLB8 interact with plant immunity and defense signaling pathways?

RTNLB8's role in plant immunity represents an emerging research direction with several important aspects to investigate:

  • Pattern recognition receptor trafficking: Given that related RTNLB proteins (RTNLB1 and 2) interact with the flagellin receptor FLS2 and affect its plasma membrane levels, RTNLB8 may similarly influence defense receptor trafficking . Key experiments should include:

    • Co-immunoprecipitation with pattern recognition receptors like EFR (recognizes Agrobacterium EF-Tu)

    • Quantification of receptor levels at the plasma membrane in rtnlb8 mutants versus wild-type

    • Analysis of receptor endocytosis rates after PAMP detection

  • Defense signaling pathway activation:

    • Measure MAPK activation kinetics in response to PAMPs in rtnlb8 mutants

    • Analyze calcium signaling using aequorin-based reporters

    • Quantify reactive oxygen species production after elicitor treatment

    • Evaluate defense gene induction using transcriptomics or reporter gene assays

  • Hormone signaling integration:

    • Analyze salicylic acid, jasmonic acid, and ethylene levels and signaling in rtnlb8 backgrounds

    • Test genetic interactions between rtnlb8 and key immunity pathway mutants (e.g., sid2, coi1, ein2)

    • Perform epistasis analysis with constitutive defense mutants

  • Callose deposition and cell wall modifications:

    • Examine callose deposition patterns after PAMP treatment in rtnlb8 mutants

    • Analyze cell wall composition changes during infection attempts

Given that RTNLB8 overexpression increases susceptibility to both A. tumefaciens and P. syringae, these experiments could reveal whether RTNLB8 represents a common target that pathogens manipulate to suppress host immunity .

What is the evolutionary significance of RTNLB8 in plant-microbe interactions?

The evolutionary analysis of RTNLB8 can provide insights into its specialized role in plant-microbe interactions:

  • Comparative genomics approach:

    • Analyze RTNLB8 orthologs across different plant species, particularly examining:

      • Conservation patterns in plants with varying susceptibility to Agrobacterium

      • Sequence divergence rates compared to other RTNLB family members

      • Selection pressure analysis (dN/dS ratios) to identify regions under positive selection

  • Functional conservation testing:

    • Express RTNLB8 orthologs from different species in Arabidopsis rtnlb8 mutants to test complementation

    • Compare VirB2-binding capacity of RTNLB8 proteins from different plant species

    • Test transformation efficiency in plants with natural RTNLB8 variants

  • Co-evolutionary analysis with pathogens:

    • Examine if A. tumefaciens strains from different hosts show adaptation to specific RTNLB8 variants

    • Analyze if pathogens produce effectors targeting RTNLB8 or its signaling pathways

  • Domain architecture analysis:

    • Compare the N-terminal domains of different RTNLB proteins, which may confer functional specificity

    • Identify conserved motifs potentially involved in pathogen recognition or defense signaling

  • Transcriptional regulation comparison:

    • Analyze RTNLB8 promoter regions across species to identify conserved regulatory elements

    • Compare expression patterns in response to various pathogens and elicitors

This evolutionary perspective could reveal whether RTNLB8's role in A. tumefaciens susceptibility represents an ancestral function or a more recent adaptation in specific plant lineages.

How can researchers address inconsistent results in RTNLB8 protein interaction studies?

Inconsistent results in RTNLB8 interaction studies are common due to its membrane protein nature. Researchers should consider:

  • Assay-specific technical considerations:

    • For yeast two-hybrid: Use split-ubiquitin or membrane-based Y2H systems specifically designed for membrane proteins

    • For in vitro pull-downs: Optimize detergent conditions carefully to maintain protein folding

    • For BiFC/FRET: Ensure proper controls for protein expression levels and subcellular localization

  • Protein orientation factors:

    • Test both N- and C-terminal tags since the study observed different results when bait and prey proteins were swapped in Y2H assays

    • Consider the natural topology of RTNLB8 in membranes when designing fusion constructs

  • Expression level standardization:

    • Quantify protein expression levels in all experimental systems

    • Use inducible promoters to achieve comparable expression levels

  • Conformational considerations:

    • The study noted that RTNLB proteins may not form the same conformation in heterologous systems as they do in plant cells

    • Include proper folding controls such as known interaction partners

  • Membrane environment recreation:

    • Include appropriate lipids when performing in vitro studies

    • Consider nanodiscs or liposome reconstitution for maintaining native-like membrane environment

A systematic comparison table documenting results across different interaction methods can help identify which inconsistencies are technical artifacts versus biologically meaningful variations.

What strategies help overcome challenges in phenotypic analysis of rtnlb mutants?

Phenotypic analysis of rtnlb mutants presents several challenges that can be addressed through these strategies:

  • Functional redundancy issues:

    • Generate higher-order mutants combining mutations in phylogenetically related RTNLB genes

    • Use CRISPR/Cas9 to create complete knockouts when T-DNA insertions result in partial loss-of-function

    • Apply chemical genetics approaches using small molecules that target multiple RTNLB proteins

  • Sensitivity enhancement for subtle phenotypes:

    • Use seedling-based transformation assays rather than root-based assays for higher sensitivity

    • Optimize bacterial concentrations (10^5-10^6 cfu·mL^-1) to better detect differences

    • Apply mild stress conditions that may enhance phenotypic differences

  • Tissue-specific analysis:

    • Analyze phenotypes in tissues where RTNLB8 shows highest expression (e.g., flowers)

    • Use tissue-specific promoters to complement mutations in specific cell types

  • Quantitative measurements:

    • Employ fluorometric GUS assays rather than histochemical staining for precise quantification

    • Use automated imaging and analysis tools for unbiased phenotypic scoring

    • Perform time-course experiments to capture transient phenotypes

  • Environmental standardization:

    • Control growth conditions precisely to reduce experimental variability

    • Include internal reference genotypes in each experiment

    • Use large sample sizes and multiple biological replicates

By implementing these strategies, researchers can overcome the challenges associated with functional redundancy and subtle phenotypic differences often encountered when studying RTNLB family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.