Recombinant Arabidopsis thaliana Reticulon-like protein B8 (RTNLB8) is a protein derived from the plant Arabidopsis thaliana, also known as mouse-ear cress . It belongs to the reticulon-like protein family . RTNLB8 is involved in various cellular processes, including the modulation of susceptibility to bacterial infections and participation in endoplasmic reticulum (ER) modeling .
Amino Acid Sequence MPDKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFDRQKPIHHVLGGGKSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGKFGLKKRE
Gene Name RTNLB8, Ordered Locus Name: At3g10260, ORF Names: F14P13.14
RTNLB8 interacts with other RTNLB proteins, such as RTNLB2 and RTNLB4, suggesting its role in ER modeling . It also interacts with the Agrobacterium tumefaciens VirB2 protein, influencing the bacterial infection process .
| Bait Protein | Prey Protein | Interaction |
|---|---|---|
| RTNLB2 | RTNLB3, RTNLB8 | Yes |
| RTNLB3 | RTNLB2, RTNLB4, RTNLB8 | Yes |
| RTNLB4 | RTNLB8 | Yes |
| RTNLB5, 6, 7, 8 | RTNLB1-8 | No |
| RTNLB1 | RTNLB3, RTNLB5-8 | No |
Genetic studies have indicated that rtnlb8 mutants show recalcitrance in Agrobacterium tumefaciens-mediated transient transformation assays . Overexpression of RTNLB8 enhances the susceptibility of transgenic plant root tissue to A. tumefaciens, suggesting its involvement in the infection process .
Overexpression of RTNLB8 in transgenic plants leads to enhanced susceptibility to P. syringae DC3000 infection, with increased bacterial numbers and more severe disease symptoms .
RTNLB8 is a member of the reticulon-like protein family in Arabidopsis thaliana. It belongs to the Group I RTNLB proteins (RTNLB1-8) which contain an N-terminal domain with 43-93 amino acid residues and a short C-terminal domain . Like other reticulon proteins, RTNLB8 contains a carboxyl-terminal reticulon (RTN) homology domain composed of two large hydrophobic regions with a ~66 amino acid loop between them . RTNLB8 is a membrane protein primarily localized in the plant endomembrane systems and has been implicated in various plant-microbe interactions, particularly during Agrobacterium tumefaciens infection processes .
Real-time PCR analysis has revealed that RTNLB8 expression varies across different Arabidopsis tissues. The highest expression levels of RTNLB8 have been detected in flowers, with relatively lower expression in roots, rosette leaves, cauline leaves, inflorescence, and siliques . This tissue-specific expression pattern differs somewhat from predictions made using the Arabidopsis eFP browser, which suggested highest abundance in cauline and rosette leaves . This discrepancy might be attributed to differences in analysis methods and plant growth stages used in different studies, highlighting the importance of experimental validation when characterizing gene expression patterns .
RTNLB8 plays a critical role in facilitating Agrobacterium-mediated transformation of plant cells. Experimental evidence shows that rtnlb8 mutant plants exhibit significant resistance to A. tumefaciens infection . In transient transformation assays using Arabidopsis seedlings, rtnlb8 mutants showed 67% to 84% decrease in transformation efficiency compared to wild-type plants . Conversely, overexpression of RTNLB8 in transgenic plants enhanced both stable and transient transformation rates by 1.3- to 2.0-fold compared with wild-type plants . These findings suggest that RTNLB8 participates in the early steps of A. tumefaciens-mediated transformation, before T-DNA integration into the plant genome .
RTNLB8 forms specific protein-protein interactions that may be crucial for its biological functions. Both yeast two-hybrid and GST pull-down assays have demonstrated that RTNLB8 interacts with:
VirB2 protein, the major component of A. tumefaciens T-pilus
Other RTNLB family members, specifically RTNLB2, RTNLB3, and RTNLB4
Interestingly, more positive interactions of RTNLB8 with VirB2 and other RTNLB proteins were detected in GST pull-down assays than in yeast two-hybrid assays . This discrepancy may be due to differences in protein conformation between the assay systems compared to native conditions in plant cells .
For studying RTNLB8-VirB2 interactions, researchers should consider multiple complementary approaches to ensure robust results. In vitro GST pull-down assays have proven more effective than yeast two-hybrid systems for detecting RTNLB8-VirB2 interactions . The protocol involves:
Expressing GST-tagged RTNLB8 in E. coli and purifying it using glutathione-agarose beads
Incubating the purified protein with in vitro translated 35S-labeled VirB2
Washing the beads and analyzing bound proteins by SDS-PAGE and autoradiography
For in vivo validation, bimolecular fluorescence complementation (BiFC) in plant cells provides spatial information about where these interactions occur within the cell. Co-immunoprecipitation from plant tissues expressing tagged versions of both proteins can further confirm the physiological relevance of these interactions. Surface plasmon resonance or isothermal titration calorimetry could provide quantitative binding parameters that characterize the strength and kinetics of RTNLB8-VirB2 interactions.
Generation and characterization of rtnlb8 mutants requires a systematic approach:
Mutant identification: T-DNA insertion lines for RTNLB8 can be obtained from stock centers like ABRC (Arabidopsis Biological Resource Center). The study used two independent T-DNA insertion lines (rtnlb8-1 and rtnlb8-2) .
Verification of insertion: Use PCR-based genotyping with gene-specific primers and T-DNA border primers to confirm the presence and location of the insertion.
Expression analysis: Perform RT-PCR and real-time PCR to verify reduced RTNLB8 transcript levels. This is critical to confirm the knockout or knockdown status of the mutant .
Phenotypic characterization:
Complementation analysis: Transform rtnlb8 mutants with wild-type RTNLB8 gene to confirm that observed phenotypes are specifically due to the loss of RTNLB8 function.
To investigate RTNLB8's role in endomembrane trafficking, researchers should employ a combination of cell biology, biochemistry, and genetics approaches:
Subcellular localization: Generate transgenic plants expressing fluorescently-tagged RTNLB8 (e.g., RTNLB8-GFP) and use confocal microscopy to determine its precise localization within the endomembrane system .
Co-localization studies: Combine RTNLB8-GFP with markers for different endomembrane compartments (ER, Golgi, endosomes) to identify which compartments RTNLB8 associates with.
Membrane topology analysis: Use protease protection assays or split-GFP approaches to determine the orientation of RTNLB8 in membranes.
Protein trafficking assays: Monitor the movement of defense-related receptors (like EFR or FLS2) in wild-type versus rtnlb8 mutant backgrounds using pulse-chase experiments with fluorescently-tagged receptors .
ER morphology analysis: Since RTNLBs are involved in ER tubular structure formation, compare ER morphology in wild-type and rtnlb8 mutant plants using ER-targeted fluorescent markers .
Electron microscopy: Use transmission electron microscopy to examine ultrastructural changes in endomembrane organization in rtnlb8 mutants.
RTNLB8 overexpression significantly alters plant responses to bacterial pathogens. Research has shown:
Enhanced susceptibility to A. tumefaciens: RTNLB8-overexpressing plants show 1.3- to 2.0-fold higher transformation rates in both stable and transient transformation assays compared to wild-type plants .
Increased susceptibility to Pseudomonas syringae: Plants overexpressing RTNLB8 exhibit hypersusceptibility to P. syringae infection .
The dual effect on both bacterial species suggests RTNLB8 may influence general aspects of plant-microbe interactions rather than pathogen-specific mechanisms. To investigate this phenomenon, researchers should:
Test susceptibility to a broader range of pathogens (bacterial, fungal, viral)
Measure expression of defense-related genes using qRT-PCR
Quantify defense hormone levels (salicylic acid, jasmonic acid)
Analyze activation patterns of defense-related MAPKs
Examine receptor trafficking in overexpression lines, particularly pattern recognition receptors like EFR and FLS2 that are crucial for bacterial recognition
A comparative analysis between RTNLB8 and other RTNLB overexpression lines (such as RTNLB1-4) would help determine if these susceptibility phenotypes represent a common feature of RTNLB proteins or are specific to RTNLB8.
To elucidate the specific mechanisms by which RTNLB8 affects A. tumefaciens transformation, a multi-faceted experimental approach is required:
Temporal analysis: Examine the effects of RTNLB8 at different stages of transformation by using:
Structure-function analysis: Generate truncated or mutated versions of RTNLB8 to identify domains critical for:
Comparative analysis with other RTNLBs: Create RTNLB8/RTNLB3 or RTNLB8/RTNLB1 double mutants to assess potential functional redundancy or synergistic effects .
Identification of plant targets: Perform co-immunoprecipitation coupled with mass spectrometry to identify additional plant proteins that interact with RTNLB8 during A. tumefaciens infection.
Time-course expression analysis: Monitor RTNLB8 expression at various timepoints after A. tumefaciens infection to determine if its expression changes in response to bacterial contact, similar to the transient increase observed for RTNLB1 .
Purification of recombinant RTNLB8 presents several technical challenges due to its nature as a membrane protein with hydrophobic domains. Researchers should consider:
Expression system selection: E. coli systems may result in inclusion bodies due to the hydrophobic nature of RTNLB8. Alternative expression systems to consider include:
Insect cell expression systems (baculovirus)
Cell-free protein synthesis systems
Yeast expression systems optimized for membrane proteins
Solubilization strategies:
Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin
Test detergent-free approaches using styrene-maleic acid copolymer (SMA) that can extract proteins with their native lipid environment
Consider nanodiscs for maintaining protein structure and function after purification
Fusion tag optimization:
Functional validation: Confirm that purified RTNLB8 retains its ability to interact with known partners like VirB2 using in vitro binding assays .
Differentiating the specific functions of RTNLB family members requires systematic comparative analysis:
Expression pattern comparison: Perform side-by-side analysis of expression patterns across tissues and developmental stages for all RTNLB proteins using:
Higher-order mutant analysis: Generate and characterize:
Single mutants for each RTNLB
Double, triple, or higher-order mutants of phylogenetically related RTNLBs
CRISPR/Cas9-mediated knockouts for genes lacking T-DNA insertions
Protein interaction network mapping:
Domain swap experiments: Create chimeric proteins by swapping domains between different RTNLB proteins to identify regions responsible for specific functions or interactions.
Response to biotic stresses: Compare the susceptibility phenotypes of different RTNLB mutants and overexpression lines to:
The data from these comparative analyses can be organized into a comprehensive table showing functional similarities and differences among RTNLB family members.
Understanding RTNLB8 membrane topology and dynamics requires specialized techniques:
Membrane topology mapping:
Protease protection assays to determine which domains are exposed to cytosol vs. lumen
Glycosylation site mapping with engineered N-glycosylation sites
Fluorescence protease protection (FPP) assay with GFP-tagged RTNLB8
Cysteine scanning mutagenesis combined with membrane-impermeable thiol-reactive reagents
Lateral mobility analysis:
Fluorescence recovery after photobleaching (FRAP) to measure diffusion rates in membranes
Single particle tracking of fluorescently-tagged RTNLB8
Fluorescence correlation spectroscopy (FCS) to analyze molecular dynamics
Membrane domain association:
Detergent-resistant membrane isolation to assess lipid raft association
Förster resonance energy transfer (FRET) with lipid domain markers
Super-resolution microscopy (STORM, PALM) to visualize nanoscale distribution
Structural studies:
Circular dichroism spectroscopy to analyze secondary structure in membrane mimetics
Hydrogen-deuterium exchange mass spectrometry to identify membrane-protected regions
Cryo-electron microscopy of RTNLB8 in nanodiscs or liposomes
Dynamic association with membrane-shaping machinery:
For studying RTNLB8's role in Agrobacterium-mediated transformation, researchers should consider these optimized experimental conditions:
Bacterial concentration optimization:
Use bacterial concentrations between 10^5 and 10^6 cfu·mL^-1 for transformation assays, as these concentrations revealed the most significant differences between wild-type and RTNLB8 overexpression plants
Perform transformation assays with a concentration series to identify the most sensitive range for detecting RTNLB8-dependent effects
Tissue selection:
Transformation assay optimization:
Genetic background considerations:
Environmental conditions:
Control temperature, light, and humidity precisely during transformation assays
Document plant age and growth stage, as these factors influence transformation efficiency
Controls and normalizations:
Include both positive controls (wild-type plants) and negative controls (known transformation-resistant mutants)
Normalize transformation efficiency data to account for variations in plant size or tissue amount
RTNLB8's role in plant immunity represents an emerging research direction with several important aspects to investigate:
Pattern recognition receptor trafficking: Given that related RTNLB proteins (RTNLB1 and 2) interact with the flagellin receptor FLS2 and affect its plasma membrane levels, RTNLB8 may similarly influence defense receptor trafficking . Key experiments should include:
Co-immunoprecipitation with pattern recognition receptors like EFR (recognizes Agrobacterium EF-Tu)
Quantification of receptor levels at the plasma membrane in rtnlb8 mutants versus wild-type
Analysis of receptor endocytosis rates after PAMP detection
Defense signaling pathway activation:
Measure MAPK activation kinetics in response to PAMPs in rtnlb8 mutants
Analyze calcium signaling using aequorin-based reporters
Quantify reactive oxygen species production after elicitor treatment
Evaluate defense gene induction using transcriptomics or reporter gene assays
Hormone signaling integration:
Analyze salicylic acid, jasmonic acid, and ethylene levels and signaling in rtnlb8 backgrounds
Test genetic interactions between rtnlb8 and key immunity pathway mutants (e.g., sid2, coi1, ein2)
Perform epistasis analysis with constitutive defense mutants
Callose deposition and cell wall modifications:
Examine callose deposition patterns after PAMP treatment in rtnlb8 mutants
Analyze cell wall composition changes during infection attempts
Given that RTNLB8 overexpression increases susceptibility to both A. tumefaciens and P. syringae, these experiments could reveal whether RTNLB8 represents a common target that pathogens manipulate to suppress host immunity .
The evolutionary analysis of RTNLB8 can provide insights into its specialized role in plant-microbe interactions:
Comparative genomics approach:
Analyze RTNLB8 orthologs across different plant species, particularly examining:
Conservation patterns in plants with varying susceptibility to Agrobacterium
Sequence divergence rates compared to other RTNLB family members
Selection pressure analysis (dN/dS ratios) to identify regions under positive selection
Functional conservation testing:
Express RTNLB8 orthologs from different species in Arabidopsis rtnlb8 mutants to test complementation
Compare VirB2-binding capacity of RTNLB8 proteins from different plant species
Test transformation efficiency in plants with natural RTNLB8 variants
Co-evolutionary analysis with pathogens:
Examine if A. tumefaciens strains from different hosts show adaptation to specific RTNLB8 variants
Analyze if pathogens produce effectors targeting RTNLB8 or its signaling pathways
Domain architecture analysis:
Compare the N-terminal domains of different RTNLB proteins, which may confer functional specificity
Identify conserved motifs potentially involved in pathogen recognition or defense signaling
Transcriptional regulation comparison:
Analyze RTNLB8 promoter regions across species to identify conserved regulatory elements
Compare expression patterns in response to various pathogens and elicitors
This evolutionary perspective could reveal whether RTNLB8's role in A. tumefaciens susceptibility represents an ancestral function or a more recent adaptation in specific plant lineages.
Inconsistent results in RTNLB8 interaction studies are common due to its membrane protein nature. Researchers should consider:
Assay-specific technical considerations:
For yeast two-hybrid: Use split-ubiquitin or membrane-based Y2H systems specifically designed for membrane proteins
For in vitro pull-downs: Optimize detergent conditions carefully to maintain protein folding
For BiFC/FRET: Ensure proper controls for protein expression levels and subcellular localization
Protein orientation factors:
Expression level standardization:
Quantify protein expression levels in all experimental systems
Use inducible promoters to achieve comparable expression levels
Conformational considerations:
Membrane environment recreation:
Include appropriate lipids when performing in vitro studies
Consider nanodiscs or liposome reconstitution for maintaining native-like membrane environment
A systematic comparison table documenting results across different interaction methods can help identify which inconsistencies are technical artifacts versus biologically meaningful variations.
Phenotypic analysis of rtnlb mutants presents several challenges that can be addressed through these strategies:
Functional redundancy issues:
Sensitivity enhancement for subtle phenotypes:
Tissue-specific analysis:
Quantitative measurements:
Employ fluorometric GUS assays rather than histochemical staining for precise quantification
Use automated imaging and analysis tools for unbiased phenotypic scoring
Perform time-course experiments to capture transient phenotypes
Environmental standardization:
Control growth conditions precisely to reduce experimental variability
Include internal reference genotypes in each experiment
Use large sample sizes and multiple biological replicates
By implementing these strategies, researchers can overcome the challenges associated with functional redundancy and subtle phenotypic differences often encountered when studying RTNLB family members.