Recombinant Arabidopsis thaliana Reticulon-like protein B9 (RTNLB9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RTNLB9; At3g18260; MIE15.5; Reticulon-like protein B9; AtRTNLB9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RTNLB9
Target Protein Sequence
MPIFTGSSSDSEDERTIHKTTKLFTRQRSIHSIFGGGKVADILLWREPKIAATLVIGVSI LWFLMEVVEYNFITLICHASMTSMLFFFIWSTASDFLNWERPLIPEVVLDESSFKQLARS FHVRFNQILTKLLDVACGRDPPLFFLTTISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVM YEMYEDDVDTAAGKLMRKMKKLYKKVDTNVLSKIPRGTVKNKKFT
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G18260

STRING: 3702.AT3G18260.1

UniGene: At.38585

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Reticulon-like protein B9 (RTNLB9)?

RTNLB9 is a member of the reticulon-like protein family in Arabidopsis thaliana, characterized by a conserved reticulon homology domain (RHD). Reticulon proteins are primarily associated with the endoplasmic reticulum (ER) membrane and contribute to membrane curvature and tubulation. Arabidopsis thaliana has become a key model system for studying basic biological processes, with its genome fully sequenced in 2000 . The Arabidopsis genome contains numerous genes with orthologs in humans and other organisms, making it valuable for studying conserved cellular mechanisms . RTNLB9 specifically contributes to the architectural organization of the ER network through its membrane-shaping properties, which influence cellular processes including protein trafficking and stress responses.

How is the expression of RTNLB9 regulated in different tissues?

RTNLB9 expression patterns can be analyzed using techniques similar to those employed for other Arabidopsis genes like ROT3 . RT-PCR analysis allows for tissue-specific expression profiling, with quantification possible through PCR with increasing cycle numbers followed by Southern hybridization . Based on studies of related reticulon family members, RTNLB9 is likely expressed across multiple tissue types including roots, seedlings, leaves, and floral tissues, though expression levels may vary. Understanding this tissue-specific expression pattern is crucial for interpreting the protein's biological functions in different developmental contexts.

What structural features characterize RTNLB9?

RTNLB9 contains the defining structural element of reticulon proteins—the reticulon homology domain (RHD), which includes two hydrophobic regions that form wedge-like insertions into the ER membrane. These insertions create local membrane curvature, essential for forming and maintaining tubular ER structures. The protein likely adopts a "hairpin" topology, with both N- and C-termini facing the cytosol. Structural analysis can be approached through techniques like those used for other Arabidopsis membrane proteins, including epitope tagging (such as FLAG or HA tags) for purification and subsequent analysis .

What cloning strategies are recommended for recombinant RTNLB9 expression?

For successful cloning and expression of recombinant RTNLB9, researchers should consider multiple approaches:

  • For bacterial expression, the full-length cDNA of RTNLB9 can be amplified and cloned into protein expression vectors like pGOOD or modified pGEX-6P vectors that include C-terminal 6xHIS tags, similar to the approach used for WRKY53 .

  • For plant expression, the genomic DNA of RTNLB9 with its native promoter (approximately 1 kb upstream) should be amplified and cloned into entry vectors like pENTR/D-TOPO before recombination into binary vectors such as pEarleyGate302 .

  • Transformation into Arabidopsis can be performed via Agrobacterium-mediated infection, with selection of transformed plants using appropriate markers .

When designing primers for cloning, researchers should include restriction sites compatible with the destination vector and ensure in-frame fusion with any epitope tags. Detailed primer design and PCR conditions should be carefully optimized for the GC content and secondary structure of the RTNLB9 sequence.

How can T-DNA insertion mutants of RTNLB9 be identified and characterized?

To study RTNLB9 function through loss-of-function approaches:

  • T-DNA insertion lines can be obtained from repositories like the Arabidopsis Biological Resource Center (ABRC), similar to approaches used for studying genes like HDA9 (SALK_007123) and PWR (SALK_071811C) .

  • Mutant verification requires PCR-based genotyping using gene-specific primers flanking the expected insertion site combined with T-DNA border primers .

  • Homozygous mutant lines should be isolated through segregation analysis, and T-DNA insertions should be confirmed by sequencing the PCR products spanning the insertion junctions .

  • RT-PCR and/or Northern blot analysis should be performed to verify the absence or reduction of RTNLB9 transcript levels in the mutant lines .

  • Phenotypic characterization should include detailed analysis of growth parameters, ER morphology, and stress responses compared to wild-type plants .

What methods are effective for studying RTNLB9 protein-protein interactions?

Multiple complementary approaches can reveal RTNLB9 interaction partners:

  • Immunoprecipitation coupled with mass spectrometry (IP-MS) is particularly powerful, as demonstrated in studies of HDA9 and PWR interactions . This approach requires generating transgenic Arabidopsis lines expressing epitope-tagged RTNLB9 (e.g., RTNLB9-FLAG) driven by its native promoter .

  • Co-immunoprecipitation (co-IP) can confirm specific interactions in plant tissues, as demonstrated by the successful detection of HDA9-PWR interactions in F1 Arabidopsis plants expressing both HA-tagged and FLAG-tagged proteins .

  • For testing direct interactions, in vitro pull-down assays using purified recombinant RTNLB9 and candidate interacting proteins can be performed.

  • Yeast two-hybrid screening provides an alternative approach for identifying binary interactions, though membrane proteins like RTNLB9 may require modifications such as using only the soluble domains.

MethodAdvantagesLimitationsSample preparation
IP-MSUnbiased discovery of multiple interacting partnersRequires generation of transgenic plantsExpression of epitope-tagged RTNLB9
Co-IPConfirms interactions in plant tissuesLimited to testing known candidatesF1 plants expressing differently tagged proteins
Yeast two-hybridTests direct binary interactionsMay give false positives/negativesCloning of RTNLB9 domains into Y2H vectors
In vitro pull-downConfirms direct physical interactionsRequires purified proteinsExpression and purification of recombinant proteins

How does RTNLB9 contribute to ER membrane curvature and remodeling?

RTNLB9, like other reticulon proteins, likely shapes ER membranes through:

  • Insertion of its hydrophobic reticulon homology domain into the outer leaflet of the ER membrane, creating wedge-like structures that induce membrane curvature.

  • Oligomerization to form arc-like scaffolds that stabilize curved membranes and tubular ER structures.

These mechanisms can be studied through a combination of approaches. Live cell imaging using fluorescently tagged RTNLB9 and ER markers in both wild-type and rtnlb9 mutant backgrounds can reveal alterations in ER morphology . Transmission electron microscopy provides higher-resolution analysis of membrane curvature changes. Protein mobility and dynamics can be assessed using fluorescence recovery after photobleaching (FRAP) techniques, providing insights into how RTNLB9 contributes to ER remodeling processes.

The impact of RTNLB9 on ER morphology may be context-dependent, with different effects under normal growth versus stress conditions, similar to the context-dependent functions observed for other Arabidopsis regulatory proteins .

What role does RTNLB9 play in plant stress responses?

Emerging evidence suggests reticulon proteins like RTNLB9 may function in plant stress adaptation through:

  • Remodeling of the ER network during stress, which may facilitate increased protein folding capacity.

  • Regulation of inter-organelle contact sites, which are important for lipid transfer and calcium signaling during stress responses.

  • Potential direct or indirect interactions with components of the unfolded protein response pathway.

To investigate these functions, researchers can analyze transcriptional responses using RNA-seq or quantitative RT-PCR to compare wild-type and rtnlb9 mutant plants under various stress conditions . Analysis pipeline should include Tophat and Cufflink for differential expression analysis, with stringent statistical thresholds (p<0.05) . Gene Ontology analysis using tools like agriGO can identify enriched functional categories among differentially expressed genes .

Phenotypic assays under various stresses (heat, drought, salt, ER stress inducers) should be conducted to determine if RTNLB9 contributes to stress tolerance. This multi-faceted approach can reveal how RTNLB9-mediated ER remodeling influences the plant's ability to adapt to challenging environments.

How do RTNLB9 functions compare with other reticulon family members in Arabidopsis?

The Arabidopsis genome contains multiple reticulon-like proteins with potentially overlapping yet distinct functions. Comparative analysis can reveal:

  • Sequence similarity and divergence in functional domains, which can be analyzed through phylogenetic methods.

  • Differential expression patterns across tissues, developmental stages, and stress conditions.

  • Functional redundancy or specialization through the analysis of single and higher-order mutants.

Southern blot analysis using RTNLB9 cDNA as a probe under different stringency conditions can reveal the presence of related sequences in the genome . Under high-stringency conditions, one to three genomic fragments might be detected, while additional fragments may appear under low-stringency conditions, indicating related gene family members .

For functional comparison, crossing single mutants to generate double or higher-order mutants can reveal synergistic phenotypes that suggest shared functions. Complementation studies, where different reticulon family members are expressed in an rtnlb9 mutant background, can determine if other family members can substitute for RTNLB9 functions.

What imaging techniques are most appropriate for visualizing RTNLB9 localization and dynamics?

Several imaging approaches are suitable for studying RTNLB9 in vivo:

  • Confocal microscopy using fluorescently tagged RTNLB9 (e.g., GFP fusion) provides good resolution for visualizing ER localization and basic network morphology.

  • High-resolution approaches including structured illumination microscopy (SIM) can provide improved visualization of fine ER structure beyond the diffraction limit.

  • For dynamics, spinning disk confocal microscopy enables rapid acquisition with reduced photobleaching, ideal for time-lapse imaging of ER remodeling.

  • Fluorescence recovery after photobleaching (FRAP) allows quantification of RTNLB9 mobility within the ER membrane.

Image acquisition parameters should be optimized for detecting the potentially low-abundance RTNLB9 protein while avoiding photobleaching. Expression under native promoters rather than strong constitutive promoters helps prevent artifacts from overexpression . For quantitative analysis, ER network parameters including tubule density, junction number, and polygon area can be measured using specialized image analysis software.

How should contradictory phenotypes in RTNLB9 studies be interpreted?

When contradictory results appear in RTNLB9 research, several factors should be considered:

To resolve contradictions, researchers should use multiple alleles of RTNLB9 (as was done for ROT3 with rot3-1, rot3-2, and rot3-3) and perform careful complementation tests to confirm that phenotypes are indeed caused by disruption of RTNLB9. Additionally, crossing mutant lines to create F1 progeny allows for testing of allelism through analysis of phenotypic complementation .

What statistical approaches are appropriate for analyzing RTNLB9 expression data?

For robust analysis of RTNLB9 expression:

  • RT-PCR with increasing cycle numbers followed by Southern blot analysis can quantify expression levels across tissues .

  • For transcriptome studies, appropriate normalization methods are essential. RNA-seq data should be analyzed using established pipelines such as Tophat and Cufflink with statistical thresholds (p<0.05) for identifying differentially expressed genes .

  • When comparing expression across multiple tissues or conditions, appropriate controls and biological replicates (minimum two) are necessary for statistical validity .

  • For ChIP-seq data analysis, MACS with appropriate p-value thresholds (p=1e-03) can be used for peak calling, while BEDTools facilitates further analysis .

Gene expression patterns of RTNLB9 can be compared with co-expressed genes to identify potential functional relationships, similar to approaches used in studying natural genetic variation in Arabidopsis .

How can findings from RTNLB9 research inform applications in crop improvement?

Research on RTNLB9 in Arabidopsis can provide valuable insights for crop improvement:

  • Many genes implicated in basic cellular processes in Arabidopsis have orthologs in crop species. The high percentage of shared "disease genes" between Arabidopsis and humans (comparable to other model organisms) suggests similar conservation with crop plants .

  • Understanding RTNLB9's role in stress responses could inform strategies for enhancing stress tolerance in crops, as ER stress responses are critical for plant adaptation to environmental challenges.

  • Natural genetic variation studies in Arabidopsis demonstrate how common and rare alleles with similar phenotypic effects can exist at the same locus . Similar variation might be found in crop orthologs of RTNLB9 that could be exploited for breeding programs.

  • The self-fertilizing habit of Arabidopsis makes it ideal for genome-wide association studies, allowing researchers to identify natural alleles that affect performance . Similar approaches could be applied to identify beneficial RTNLB9 variants in crop species.

The deep understanding of gene function from Arabidopsis can guide targeted modifications in crops, leveraging the evolutionary conservation of basic cellular processes across plant species.

How does the study of RTNLB9 connect to broader questions in plant cell biology?

RTNLB9 research connects to fundamental questions about cellular organization and evolution:

  • The study of membrane-shaping proteins like RTNLB9 provides insights into how cells establish and maintain organelle architecture, a basic feature of eukaryotic cells.

  • Understanding the role of RTNLB9 in stress responses contributes to our knowledge of how plants adapt to environmental challenges, a key aspect of plant evolution and ecology.

  • Comparative genomic and proteomic studies between Arabidopsis and other organisms have opened new research avenues, as demonstrated by studies comparing Arabidopsis (which lacks centrioles) with the alga Chlamydomonas (which has them) .

  • The diversification of the reticulon family in plants compared to animals suggests potential plant-specific adaptations in ER organization that may relate to unique aspects of plant cell biology.

These connections illustrate how focused studies on specific proteins like RTNLB9 contribute to our broader understanding of fundamental cellular processes and evolutionary adaptations in plants.

What emerging technologies could advance RTNLB9 research?

Several cutting-edge approaches promise to enhance our understanding of RTNLB9:

  • CRISPR-Cas9 gene editing allows for precise manipulation of the RTNLB9 locus, enabling targeted mutations in specific domains to dissect structure-function relationships.

  • Advanced proteomics approaches, including proximity labeling (BioID) or cross-linking mass spectrometry, can identify transient or context-specific interaction partners of RTNLB9.

  • Cryo-electron microscopy could potentially resolve the structure of RTNLB9 in its membrane environment, providing unprecedented insights into how it shapes ER membranes.

  • Super-resolution microscopy techniques beyond the diffraction limit can reveal fine details of RTNLB9 distribution and ER morphology not visible with conventional microscopy.

  • Single-cell transcriptomics and spatial transcriptomics could reveal cell-type specific expression patterns and functions of RTNLB9 that might be masked in whole-tissue analyses.

These technological advances will enable researchers to address long-standing questions about RTNLB9 function with greater precision and depth.

What are the most significant unresolved questions about RTNLB9 function?

Despite progress in understanding reticulon proteins, several key questions about RTNLB9 remain unanswered:

  • How is RTNLB9 activity regulated in response to developmental or environmental cues? Potential post-translational modifications or protein-protein interactions may modulate its membrane-shaping activity.

  • Does RTNLB9 have functions beyond basic ER shaping, such as roles at membrane contact sites between the ER and other organelles?

  • How does the plant-specific evolution of reticulon proteins like RTNLB9 relate to unique aspects of plant cell biology?

  • What is the significance of potential redundancy and specialization among reticulon family members in Arabidopsis?

Addressing these questions will require integrating multiple experimental approaches, from molecular genetics to advanced imaging and biochemistry. The answers will contribute to our fundamental understanding of membrane organization in plant cells and potentially reveal new strategies for enhancing plant stress resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.