Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 4, chloroplastic (STR4)

Shipped with Ice Packs
In Stock

Description

General Information

CharacteristicDescription
NameRecombinant Full Length Arabidopsis thaliana Rhodanese-Like Domain-Containing Protein 4, Chloroplastic(Str4) Protein, His-Tagged
SynonymsSTR4, TROL, At4g01050, F2N1.31, Rhodanese-like domain-containing protein 4, chloroplastic, Protein THYLAKOID RHODANESE-LIKE, Sulfurtransferase 4, AtStr4
SpeciesArabidopsis thaliana
LocalizationChloroplast, specifically thylakoid membranes
Molecular WeightApproximately 43 kDa (Mature Protein)
Uniprot IDQ9M158
Amino Acid SequenceLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLSQVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIKDGAEGPRGWLNSSLPWIEPKKTLSLDLSSLTDSISGVFGESSDGVSVALGVAAAAGLSVFAFTEIETILQLLGSAALVQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKALPAPATVTAEAESATATTTTVDKPVPEPETVAATTTTVDKPVPEPEPVPEPVPVPAIEAAVAAQVITEPTETEAKPKPHSRPLSPYASYPDLKPPSSPMPSQP

Structure and Domains

TROL is composed of several structurally and functionally distinct regions :

  • An N-terminal stromal domain that includes a chloroplast targeting pre-sequence .

  • Two transmembrane domains .

  • A rhodanese-like domain (RHO) located in the thylakoid lumen .

  • A C-terminal domain protruding into the stroma, containing a proline-rich region (PEPE) for flexibility and an ITEP domain responsible for protein-protein recognition and interaction with the FNR dimer .

Function

TROL is involved in several key functions within the chloroplast:

  • Interaction with Ferredoxin:NADP+ Oxidoreductase (FNR) TROL interacts dynamically with FNR, a crucial enzyme in photosynthetic energy conversion and redox homeostasis . This interaction is light-dependent and influenced by chloroplast energetic needs, prioritizing either energy production or dissipation .

  • Redox Homeostasis TROL plays a role in the redox poising of both thylakoids and stroma . It may also interact with the thylakoid form of ascorbate peroxidase (tAPX), an enzyme involved in H2O2-dependent oxidation of ascorbate, further contributing to redox homeostasis .

  • Response to Oxidative Stress Overexpression of TROL leads to increased propagation of superoxide radicals (O2- −) under high light stress, suggesting a role in the plant's response to oxidative stress . Elevated glutathione levels in TROL-overexpressing plants indicate an increased demand for reactive oxygen species (ROS) scavengers .

Role in Abiotic Stress Tolerance

While STR4/TROL itself is not directly mentioned in the context of lead (Pb) tolerance, other rhodanese-like proteins and related mechanisms are relevant:

  • Lead Tolerance Mechanisms Studies on Arabidopsis thaliana have identified genes like EXTENSIN18 (EXT18) and TLC (TRAM-LAG1-CLN8) as key players in lead homeostasis . Lead-tolerant accessions employ strategies such as low lead translocation and accumulation in root cell walls, or high lead translocation and efflux to inactive organelles .

  • Gene Expression Higher expression of EXT18 and HMA3 contributes to lead deposition in roots, while upregulation of TLC and ABC transporters facilitates lead encapsulation in leaves .

Experimental Information

CategoryInformation
SourceE. coli
TagHis tag
Protein LengthFull Length of Mature Protein (70-466 aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Related ProductsRecombinant Proteins
Handling PrecautionsRepeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

Arabidopsis thaliana as a Model Organism

Arabidopsis thaliana is a widely used model organism in plant biology due to its simple genetics, short life cycle, and ease of cultivation . Key research areas include:

  • Genetics and Genomics: Examining gene function and regulation, including gene interactions, mutations, and roles in development and stress responses .

  • Plant Development: Studying developmental processes such as embryogenesis, leaf and flower development, and root architecture .

  • Signal Transduction: Investigating how plants perceive and respond to environmental signals, including hormone signaling pathways and stress responses .

  • Plant-Microbe Interactions: Studying plant responses to pathogens and symbiotic interactions with microorganisms, including immune responses and mutualistic relationships .

  • Metabolic Pathways: Investigating plant metabolic pathways, including secondary metabolism and responses to environmental changes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
STR4; TROL; At4g01050; F2N1.31; Rhodanese-like domain-containing protein 4, chloroplastic; Protein THYLAKOID RHODANESE-LIKE; Sulfurtransferase 4; AtStr4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
70-466
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
STR4
Target Protein Sequence
LTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLSQVLNKKPKS WGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLK KLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIKDGAEGPRGWLNSSLPWI EPKKTLSLDLSSLTDSISGVFGESSDGVSVALGVAAAAGLSVFAFTEIETILQLLGSAAL VQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKALPAPAT VTAEAESATATTTTVDKPVPEPETVAATTTTVDKPVPEPEPVPEPVPVPAIEAAVAAQVI TEPTETEAKPKPHSRPLSPYASYPDLKPPSSPMPSQP
Uniprot No.

Target Background

Function
Rhodanese domain-containing protein essential for anchoring ferredoxin-NADP reductase to thylakoid membranes, thereby maintaining efficient linear electron flow (LEF).
Gene References Into Functions
  • An Ile67 substitution for Ala67 disrupts stromal processing, redirecting the entire in vitro translated TROL pool to the chloroplast inner envelope. PMID: 29443882
  • TROL (thylakoid rhodanese-like protein) is a nuclear-encoded thylakoid membrane component crucial for FNR tethering and sustaining efficient linear electron flow (LEF) in Arabidopsis. PMID: 19682289
Database Links

KEGG: ath:AT4G01050

STRING: 3702.AT4G01050.1

UniGene: At.22549

Subcellular Location
Plastid, chloroplast envelope. Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and stems, and at lower levels in flowers and siliques (at protein level).

Q&A

What is Arabidopsis thaliana STR4 and what are its key characteristics?

STR4 (Rhodanese-like domain-containing protein 4, chloroplastic precursor) is a protein found in Arabidopsis thaliana, identified by UniProt accession number Q9M158. This protein is characterized by its rhodanese-like domain and chloroplastic localization. The gene is officially named STR4 with the ordered locus name At4g01050 and has the synonym TROL (also referenced as F2N1.31 in some databases) . Rhodanese-like domain-containing proteins typically participate in sulfur metabolism or redox reactions, though the specific functions of STR4 are still being elucidated through ongoing research.

How is STR4 classified within the broader context of Arabidopsis proteins?

STR4 belongs to the family of rhodanese-like domain-containing proteins in Arabidopsis thaliana. These proteins are characterized by their thiosulfate sulfurtransferase activity and play various roles in plant metabolism. STR4 specifically is classified as a chloroplastic protein, suggesting its involvement in chloroplast-specific processes . Within the PRO database, it is categorized under "organism-gene" with the short label "At-STR4," indicating its organism-specific nature within the broader family of rhodanese-like domain proteins.

What is the subcellular localization of STR4 and how does this relate to its function?

STR4 is localized to the chloroplast, as indicated by its full name "Rhodanese-like domain-containing protein 4, chloroplastic precursor" . This chloroplastic localization suggests potential roles in processes such as photosynthesis, redox regulation, or sulfur metabolism within this organelle. Similar to how other chloroplastic proteins function in Arabidopsis, the specific localization pattern within the chloroplast (stroma, thylakoid membrane, or other subcompartments) may provide additional clues about its precise function and interaction partners.

What are the most effective methods for expressing recombinant STR4 for structural studies?

For expressing recombinant STR4, researchers should consider several expression systems with optimization for chloroplastic proteins. Bacterial expression systems using E. coli BL21(DE3) with pET vectors have proven effective for many Arabidopsis proteins. When expressing STR4, consider these methodological approaches:

  • Clone the mature protein sequence (without the chloroplast transit peptide) to improve solubility

  • Express at lower temperatures (16-18°C) to enhance proper folding

  • Use specialized solubility tags such as MBP or SUMO

  • Consider codon optimization for the expression host

  • For structural studies, incorporate affinity tags that can be cleaved post-purification using TEV or other specific proteases

Purification should include multiple chromatography steps (affinity, ion exchange, and size exclusion) to ensure high purity for structural analysis. For crystallography, storage buffers should be optimized based on protein stability assessments using thermal shift assays.

How do post-translational modifications affect STR4 function, and what techniques are best suited to study them?

Post-translational modifications (PTMs) likely play a significant role in regulating STR4 function. Based on information from similar chloroplastic proteins, potential modifications may include phosphorylation, redox-based modifications of cysteine residues, and proteolytic processing of the transit peptide.

To study these PTMs:

  • Use mass spectrometry-based approaches such as LC-MS/MS with enrichment strategies for specific modifications (e.g., TiO₂ for phosphopeptides)

  • Employ site-directed mutagenesis to create variants where potential PTM sites are substituted

  • Develop phospho-specific antibodies for immunodetection if phosphorylation sites are identified

  • Apply redox proteomics approaches to identify thiol-based modifications

  • Use iPTMnet databases to predict potential modification sites based on homology

Researchers should correlate identified modifications with functional assays to determine their physiological relevance in different environmental conditions or developmental stages.

What are the current hypotheses regarding the role of STR4 in stress response mechanisms in Arabidopsis?

While specific data on STR4's role in stress response is limited in the provided search results, rhodanese-like domain proteins often function in redox homeostasis and sulfur metabolism, which are crucial for plant stress responses. By extrapolating from research on stress-regulated proteins in Arabidopsis, several hypotheses can be formulated:

  • STR4 may participate in detoxification of reactive oxygen species generated during abiotic stress

  • It could be involved in sulfur metabolism pathways that are upregulated during certain stress conditions

  • The protein might function in signaling cascades triggered by environmental stressors

  • It may interact with stress-responsive chloroplastic proteins to maintain photosynthetic efficiency

To test these hypotheses, researchers could analyze STR4 expression patterns under various stress conditions (such as the approaches used for STP4, which showed stress-regulated expression ), generate knockout or overexpression lines, and perform comparative proteomics to identify interaction partners during stress conditions.

How can one design effective knockout and complementation studies for STR4 in Arabidopsis?

For effective knockout and complementation studies of STR4, researchers should implement the following methodological approach:

  • Generate knockout mutants using:

    • T-DNA insertion lines from repositories like ABRC or NASC

    • CRISPR-Cas9 system targeting specific regions of the STR4 gene

    • RNAi constructs for knockdown if complete knockout is lethal

  • For complementation studies:

    • Clone the native STR4 gene including its promoter region into a plant transformation vector

    • Create constructs with tissue-specific or inducible promoters to study context-dependent functions

    • Include epitope tags (HA, FLAG, GFP) for protein localization and interaction studies

    • Consider using Agrobacterium-mediated transformation as described in search result

  • Phenotypic analysis should include:

    • Growth measurements under normal and stress conditions

    • Chloroplast structure and function assays

    • Metabolomic profiling focusing on sulfur-containing compounds

    • Comparative transcriptomics to identify affected pathways

This approach parallels successful strategies used for studying other Arabidopsis genes as described in search result , where gene complementation confirmed functional conservation between species.

What protein-protein interaction methods are most suitable for identifying STR4 binding partners in chloroplasts?

To identify STR4 binding partners in chloroplasts, researchers should consider these specialized approaches:

  • In vivo methods:

    • Split-GFP or BiFC specifically optimized for chloroplast proteins

    • Co-immunoprecipitation following crosslinking to capture transient interactions

    • Proximity-dependent biotin labeling (BioID or TurboID) with chloroplast-targeting sequences

  • In vitro methods:

    • Pull-down assays using recombinant STR4 as bait against chloroplast extracts

    • Yeast two-hybrid screening with modifications for membrane proteins if STR4 has membrane associations

    • Protein arrays containing chloroplast proteins

  • Systems biology approaches:

    • Comparative co-expression analysis across various conditions

    • Chloroplast interactome mapping using mass spectrometry

    • Computational prediction of interactions based on structural domains

When designing these experiments, researchers should consider the potential for rhodanese domains to form dimers and higher-order complexes, similar to what has been observed with starch synthase 4 (SS4) in Arabidopsis chloroplasts, which forms functionally important dimers .

How should researchers design experiments to distinguish between the functions of different STR family members in Arabidopsis?

Distinguishing between functions of different STR family members requires systematic approaches:

  • Comparative expression analysis:

    • Tissue-specific and developmental stage-specific qRT-PCR for all STR family genes

    • Promoter-reporter fusions to visualize expression patterns

    • Single-cell RNA-seq to identify cell type-specific expression

  • Genetic approaches:

    • Generate single and higher-order mutants (double, triple, etc.) to identify redundancy

    • Create chimeric proteins swapping domains between STR family members

    • Perform complementation tests using different STR genes in various mutant backgrounds

  • Biochemical characterization:

    • Compare substrate specificities using recombinant proteins

    • Measure enzyme kinetics under identical conditions

    • Conduct structural analysis to identify unique features

  • Subcellular localization studies:

    • Use fluorescent protein fusions to precisely map localization patterns

    • Perform fractionation studies to confirm organellar association

    • Use super-resolution microscopy to distinguish potential microdomains within organelles

This systematic approach would help delineate the unique and overlapping functions of STR family members, similar to how the distinct roles of other protein families have been established in Arabidopsis .

What are the optimal conditions for extracting and purifying native STR4 from Arabidopsis tissues?

For optimal extraction and purification of native STR4 from Arabidopsis tissues, researchers should follow these methodological steps:

  • Tissue selection and preparation:

    • Use tissues with highest STR4 expression (likely young leaves with active chloroplasts)

    • Harvest material in the morning when chloroplast proteins are typically abundant

    • Flash-freeze tissues immediately in liquid nitrogen to prevent degradation

  • Extraction buffer optimization:

    • Use chloroplast isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.6, 1 mM MgCl₂)

    • Include protease inhibitors (PMSF, leupeptin, E-64)

    • Add reducing agents (DTT or β-mercaptoethanol) to maintain thiol groups

    • Consider including phosphatase inhibitors if studying phosphorylation states

  • Purification strategy:

    • First isolate intact chloroplasts using Percoll gradient centrifugation

    • Lyse chloroplasts with gentle detergents (0.5% Triton X-100 or digitonin)

    • Perform ammonium sulfate fractionation as initial concentration step

    • Use a combination of ion exchange, hydroxyapatite, and affinity chromatography

    • Consider immunoprecipitation if specific antibodies are available

  • Quality control:

    • Verify protein identity using western blotting and mass spectrometry

    • Assess purity using SDS-PAGE and activity assays

    • Evaluate oligomeric state using native PAGE and size exclusion chromatography

This protocol incorporates best practices from chloroplastic protein purification methods and should be optimized based on the specific properties of STR4.

What are the most reliable antibody-based methods for detecting and quantifying STR4 in plant samples?

For reliable detection and quantification of STR4 using antibody-based methods:

  • Antibody development:

    • Generate peptide antibodies against unique regions of STR4 not conserved in other STR family members

    • Consider using the full recombinant protein for polyclonal antibody production

    • Validate antibody specificity using knockout mutants as negative controls

  • Western blot optimization:

    • Transfer proteins using semi-dry transfer for chloroplastic proteins

    • Block with 5% non-fat milk or BSA in TBS-T

    • Optimize primary antibody dilution (typically 1:1000 to 1:5000)

    • Use secondary antibodies conjugated to HRP or fluorescent labels

    • Include loading controls specific for chloroplast proteins (e.g., RbcL)

  • Immunolocalization techniques:

    • Fix tissues with formaldehyde or other crosslinkers to preserve subcellular structures

    • Use chloroplast markers for co-localization studies

    • Apply confocal microscopy for high-resolution imaging

    • Consider electron microscopy with immunogold labeling for precise localization

  • Quantification methods:

    • Use ELISA for absolute quantification

    • Apply multiplexed Western blotting for comparing expression across samples

    • Consider using automated Western platforms for higher reproducibility

These approaches should be validated using appropriate controls including recombinant STR4 standards and samples from str4 knockout plants.

How can researchers effectively analyze the enzymatic activity of STR4 and what are the appropriate assay conditions?

To effectively analyze STR4 enzymatic activity, researchers should consider:

  • Substrate identification and preparation:

    • Test canonical rhodanese substrates (thiosulfate, mercaptopyruvate)

    • Explore other potential substrates based on metabolomic analysis of str4 mutants

    • Prepare fresh substrate solutions before each assay to prevent oxidation

  • Assay conditions optimization:

    • Buffer: Typically 100 mM Tris-HCl or phosphate buffer, pH 7.5-8.0

    • Temperature: Conduct initial assays at 25°C for Arabidopsis proteins

    • Cofactors: Test potential requirements for metal ions (Fe²⁺, Zn²⁺, Mg²⁺)

    • Reducing environment: Include DTT or GSH to maintain thiol groups

  • Detection methods:

    • Spectrophotometric assays for sulfite production (using DTNB for thiol detection)

    • Coupled enzyme assays if direct product detection is challenging

    • HPLC or LC-MS for detecting and quantifying reaction products

    • Radiometric assays using labeled substrates for high sensitivity

  • Kinetic analysis:

    • Determine Km and Vmax by varying substrate concentrations

    • Analyze the effects of pH and temperature on enzyme activity

    • Test potential inhibitors and activators

    • Examine the influence of potential PTMs on activity

These methodologies should be accompanied by appropriate controls, including heat-inactivated enzyme and reactions without substrate or enzyme to account for background signals.

How can knowledge about STR4 in Arabidopsis be translated to crop improvement research?

Translating STR4 research from Arabidopsis to crop improvement involves several strategic approaches:

  • Ortholog identification and functional conservation:

    • Identify STR4 orthologs in major crops using bioinformatic approaches

    • Perform protein sequence alignments to determine conservation of key domains

    • Conduct phylogenetic analysis to identify potential functional divergence

  • Validation through complementation studies:

    • Express crop STR4 orthologs in Arabidopsis str4 mutants to confirm functional conservation

    • This approach, similar to what was done with CUC genes in sugarcane , can rapidly confirm ortholog function

  • Translation to crop systems:

    • Generate transgenic crops with modified expression of STR4 orthologs

    • Utilize CRISPR-Cas9 to create targeted mutations in crop STR4 genes

    • Test the effects on stress tolerance, photosynthetic efficiency, and sulfur metabolism

  • Phenotypic analysis in field conditions:

    • Evaluate transgenic crops under various environmental conditions

    • Measure yield components, stress tolerance, and metabolite profiles

    • Conduct multi-year trials to assess stability of the observed effects

This translational approach leverages Arabidopsis as a model system to accelerate crop improvement, similar to strategies that have been successfully employed with other genes such as SDIR1 for drought tolerance in tobacco and rice .

What bioinformatic tools and resources are most valuable for comparative analysis of STR4 across different plant species?

For comparative analysis of STR4 across plant species, researchers should utilize these bioinformatic resources:

  • Sequence databases and tools:

    • UniProt/Swiss-Prot for curated protein information

    • PLAZA and Phytozome for plant comparative genomics

    • MUSCLE or CLUSTAL for multiple sequence alignments

    • MEGA or RAxML for phylogenetic tree construction

  • Structural prediction resources:

    • AlphaFold2 or RoseTTAFold for protein structure prediction

    • ConSurf for evolutionary conservation mapping onto structures

    • PyMOL or UCSF Chimera for structural visualization and analysis

  • Expression and regulation databases:

    • BAR eFP Browser for tissue-specific expression patterns

    • ATTED-II for co-expression network analysis

    • PlantRegMap for transcription factor binding site prediction

  • Specialized PTM resources:

    • iPTMnet for post-translational modification prediction and comparison

    • PhosPhAt for plant phosphorylation sites

    • Plant-PrAS for redox-sensitive proteins

  • Functional prediction tools:

    • InterPro for domain identification

    • Gene Ontology enrichment analysis

    • KEGG Orthology for pathway mapping

These tools would allow researchers to identify conserved features of STR4 proteins across species, predict their functions in non-model plants, and guide experimental design for crop studies.

How does the function of STR4 in Arabidopsis compare to similar proteins in other model plant systems?

Comparative analysis of STR4 function across model plant systems reveals both conservation and diversification:

  • Evolutionary conservation patterns:

    • Rhodanese-like domain proteins are present in diverse plant lineages, suggesting fundamental roles

    • The chloroplastic localization is typically conserved, indicating similar subcellular functions

    • Sequence conservation is highest in catalytic regions, while regulatory domains may show greater divergence

  • Functional comparison across species:

    • In Brachypodium (a monocot model), rhodanese-like proteins may show similar dimerization properties as seen with other chloroplastic proteins like SS4

    • In Medicago (a legume model), these proteins may have additional roles in nodulation and symbiotic nitrogen fixation

    • In Populus (a tree model), they may be involved in long-term responses to environmental stresses

  • Species-specific adaptations:

    • Expression patterns may vary based on species-specific developmental programs

    • Regulatory mechanisms (transcriptional, post-transcriptional, post-translational) may differ

    • Interaction networks may include species-specific partners reflecting ecological niches

  • Experimental evidence from cross-species studies:

    • Functional complementation experiments can determine the degree of conservation

    • Heterologous expression studies can reveal differences in biochemical properties

    • Comparative phenotyping of mutants can identify divergent physiological roles

This comparative approach provides insights into the core functions of STR4 that are evolutionarily conserved and those that represent species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.