Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 4A, chloroplastic (STR4A)

Shipped with Ice Packs
In Stock

Description

Basic Identification

Rhodanese-like domain-containing protein 4A, chloroplastic (STR4A) is encoded by the STR4A gene in Arabidopsis thaliana (mouse-ear cress), a model organism widely used in plant molecular biology. The protein is formally identified by the UniProt accession number Q56XR7 with the UniProt ID STR4A_ARATH . In the Arabidopsis genome, STR4A is located at the chromosomal locus At3g25480, also referenced as MWL2.9 in some genomic annotations . The Protein Ontology (PRO) database categorizes this protein under the ID PR:Q56XR7 with the short label At-STR4A, falling into the "organism-gene" category .

Taxonomic Classification and Family Relationships

STR4A belongs to the sulfurtransferase (STR) family, a large and complex group of proteins characterized by the presence of at least one rhodanese domain. STRs are present across all three domains of life but exhibit considerable variability in their structural organization and functional properties . Within the photosynthetic organisms, STRs have been classified into nine distinct clusters based on their primary sequence characteristics and domain arrangements . Recent comparative genomics studies have revealed that STR4A is positioned within the plant-specific STR clusters (IV, V, or VI), which predominantly contain chloroplast-localized isoforms .

Domain Architecture

STR4A's defining feature is the presence of a rhodanese-like domain, which is characterized by a specific structural fold responsible for its sulfurtransferase activity. The rhodanese domain exhibits an α/β fold with a central active site containing a catalytic cysteine residue critical for the formation of a cysteine persulfide (Cys-SSH) intermediate during the sulfur transfer reaction . This domain architecture is evolutionarily conserved and found in various proteins involved in diverse cellular processes ranging from detoxification to redox signaling .

Sequence Features and Active Site

The active site of rhodanese-domain proteins typically contains a signature motif that influences substrate specificity. While the specific active site sequence of STR4A has not been explicitly detailed in the available literature, the general pattern observed in rhodanese proteins includes a CRKGVT motif where the positive charges at the arginine and lysine residues are predicted to interact with negatively charged substrates such as thiosulfate . The catalytic mechanism involves a conserved cysteine residue that forms a persulfide intermediate during the reaction cycle .

Chloroplastic Localization

As indicated by its name, STR4A contains a chloroplastic targeting sequence that directs its localization to the chloroplast. This subcellular targeting is consistent with the observation that many plant-specific STR isoforms are predominantly found in chloroplasts, suggesting specialized functions in plastid metabolism . The chloroplastic localization implies that STR4A may participate in sulfur metabolism processes specific to this organelle, potentially involving photosynthetic or stress response pathways.

Enzymatic Activity

STR4A, like other members of the rhodanese/sulfurtransferase family, is implicated in sulfur transfer reactions. The general reaction catalyzed by rhodanese enzymes involves the transfer of sulfur from a donor substrate to a recipient molecule, typically following this reaction:

Thiosulfate + Cyanide → Sulfite + Thiocyanate

The catalytic cycle involves two half-reactions:

  1. The sulfur is transferred from a donor to the active site cysteine, forming a cysteine persulfide (Cys-SSH) intermediate

  2. The outer sulfur from the Cys-SSH intermediate is transferred to a thiophilic acceptor, regenerating the resting enzyme

While the specific substrates and kinetic parameters for STR4A have not been explicitly documented in the available literature, its rhodanese domain suggests involvement in sulfur metabolism pathways.

Proposed Biological Functions

Several potential biological functions can be inferred for STR4A based on the known roles of rhodanese-domain proteins in plants:

  1. Sulfur metabolism: Participation in the mobilization and trafficking of sulfur within chloroplasts

  2. Cyanide detoxification: Potential role in detoxifying cyanide by converting it to thiocyanate

  3. Redox signaling: Possible involvement in redox-related signaling pathways within chloroplasts

  4. Stress response: Participation in plant responses to various environmental stressors

Recent research on plant sulfurtransferases suggests they may function as sulfur carriers in diverse molecular and signaling processes . For instance, a related protein, AtSTR4/TROL (thylakoid rhodanese-like protein), serves as a docking site for anchoring the ferredoxin:NADP+ oxidoreductase, indicating that some STR proteins may have structural roles beyond direct catalytic functions .

Research Antibodies

Antibodies targeting STR4A are also commercially available for research applications:

Conservation and Diversity in Photosynthetic Organisms

The sulfurtransferase family, including STR4A, has undergone significant expansion and diversification in photosynthetic organisms through evolution. Comparative genomics studies have revealed that higher plants possess multiple STR isoforms distributed across nine distinct clusters based on sequence similarity and domain architecture . This diversification suggests functional specialization of different STR proteins in various aspects of plant metabolism and development.

Relationship to Other Rhodanese-Domain Proteins

Rhodanese domains are found in diverse proteins across all domains of life. The rhodanese structural fold has been evolutionarily adapted for various functions beyond sulfur transfer, including phosphatase activity, heat shock response, and ubiquitin processing . STR4A represents one specialized member of this ancient and versatile protein superfamily that has been adapted for chloroplast-specific functions in plants.

The rhodanese domain shares evolutionary relationships with several protein families, including:

  • Cdc25 phosphatase catalytic domains

  • Non-catalytic domains of MAPK-phosphatases

  • Heat shock proteins

  • Cold-shock and phage shock proteins

  • Plant senescence-associated proteins

This evolutionary relationship highlights the versatility and functional plasticity of the rhodanese structural fold throughout evolution.

Knowledge Gaps and Research Opportunities

Despite the identification and preliminary characterization of STR4A, several knowledge gaps remain that present opportunities for future research:

  1. Substrate specificity: Determining the preferred substrates and kinetic parameters of STR4A would provide insights into its specific biochemical function.

  2. Protein interactions: Identifying interaction partners of STR4A could reveal its integration within chloroplast metabolic networks.

  3. Physiological roles: Understanding the phenotypic consequences of STR4A mutation or overexpression would clarify its importance in plant development and stress responses.

  4. Regulatory mechanisms: Investigating how STR4A expression and activity are regulated under different environmental conditions would elucidate its role in plant adaptation.

Potential Applications

Research on STR4A and related rhodanese-domain proteins may have practical applications in several areas:

  1. Crop improvement: Understanding sulfur metabolism in chloroplasts could inform strategies for enhancing nutrient use efficiency in crops.

  2. Stress tolerance: Insights into the role of STR4A in stress responses might contribute to developing plants with improved tolerance to environmental challenges.

  3. Biotechnology: The sulfurtransferase activity of STR4A could potentially be harnessed for biotechnological applications involving sulfur compound transformations.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
STR4A; At3g25480; MWL2.9; Rhodanese-like domain-containing protein 4A, chloroplastic; Sulfurtransferase 4A; AtStr4a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
61-264
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
STR4A
Target Protein Sequence
ASESFDSISSDPSSGKIDLESILVTIDNFFNKYPFFVAGCTFTYLVVYPAVMFYLRKYKP ISAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGKSSVQVPFSENDEEGFLTKVK GSFSDAENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIRGGARGKNGWLAIQEELLPPP VHMYTAKNVKSSNNNEASVVGTEN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G25480

STRING: 3702.AT3G25480.1

UniGene: At.37383

Subcellular Location
Plastid, chloroplast. Membrane; Single-pass membrane protein.

Q&A

What is STR4A and how is it classified among plant proteins?

STR4A (Rhodanese-like domain-containing protein 4A) is a chloroplastic protein in Arabidopsis thaliana belonging to the rhodanese/cell cycle control phosphatase superfamily. It is encoded by the gene AT3G25480 . In plants, rhodanese-like proteins are often designated as sulfurtransferases (STRs), which explains the prefix in the protein's name. STR4A is specifically the "4A" variant, suggesting it may be part of a subfamily within the larger STR family in Arabidopsis. This protein is localized to chloroplasts, indicating potential involvement in chloroplast-specific processes, possibly related to sulfur metabolism, redox regulation, or stress responses .

What expression systems are used for producing recombinant STR4A?

Recombinant STR4A is produced using several expression systems:

  • E. coli-based expression systems: Most commercially available recombinant STR4A is produced in bacterial systems, which allow for high protein yields .

  • Cell-free expression systems: These systems offer advantages for producing proteins that might be difficult to express in cellular systems. According to available commercial information, cell-free expression systems can achieve ≥85% purity as determined by SDS-PAGE for recombinant STR4A .

  • In vitro E. coli expression systems: These specialized systems combine the advantages of bacterial expression with enhanced control over the expression environment .

When expressing recombinant STR4A, researchers typically use the mature protein sequence (positions 61-264) without the chloroplast transit peptide to improve solubility and proper folding .

What are the recommended protocols for extracting and purifying chloroplastic proteins like STR4A from Arabidopsis tissues?

Efficient extraction and purification of chloroplastic proteins like STR4A requires specific protocols to maintain protein integrity:

  • Chloroplast isolation:

    • Harvest young Arabidopsis leaves (10-14 days old) in the middle of the light period when chloroplasts are most abundant.

    • Homogenize tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 5 mM ascorbate) at 4°C.

    • Filter the homogenate through miracloth and centrifuge at 1,000g for 5 minutes to pellet chloroplasts.

    • Resuspend the pellet and purify intact chloroplasts using a Percoll gradient .

  • Protein extraction:

    • Lyse purified chloroplasts using a buffer containing 100 mM Tris-HCl pH 8.0, 10 mM MgCl₂, 1 mM EDTA, 1 mM DTT, and protease inhibitor cocktail.

    • For transmembrane or membrane-associated proteins like STR4A, include 0.5-1% mild detergent (e.g., n-dodecyl-β-D-maltoside) in the extraction buffer .

    • Sonicate briefly and centrifuge at 16,000g to separate soluble and membrane fractions.

  • Immunoprecipitation approach:

    • For specific isolation of native STR4A, use anti-STR4A antibodies (commercially available) conjugated to magnetic beads or agarose resin .

    • Incubate chloroplast extract with antibody-conjugated beads for 2-4 hours at 4°C.

    • Wash extensively and elute with low pH buffer or SDS sample buffer for SDS-PAGE analysis.

This extraction approach allows researchers to isolate native STR4A while preserving its potential interaction partners and post-translational modifications .

How can researchers effectively design experiments to study STR4A's potential role in plant stress responses?

To investigate STR4A's function in stress responses, a comprehensive experimental design should include:

  • Expression analysis:

    • Monitor STR4A transcript levels using RT-qPCR across different stress conditions (drought, salt, heat, cold, oxidative stress).

    • Analyze protein abundance changes using Western blot with anti-STR4A antibodies .

    • Create promoter-GUS fusion constructs to visualize tissue-specific expression patterns under stress conditions .

  • Genetic approaches:

    • Generate and characterize knockout/knockdown mutants using T-DNA insertion lines or CRISPR/Cas9.

    • Create overexpression lines using CaMV 35S or native promoters.

    • Perform complementation studies to confirm phenotype rescue.

    • These genetic tools can help establish the causal relationship between STR4A and observed stress responses .

  • Phenotypic analysis:

    • Compare wild-type and mutant responses to various stresses by measuring:

      • Germination rates and seedling development under stress conditions

      • Photosynthetic parameters (Fv/Fm, ETR, NPQ)

      • Chlorophyll content and chloroplast ultrastructure

      • Reactive oxygen species (ROS) levels using fluorescent probes

      • Accumulation of stress-related metabolites (proline, osmolytes)

      • Abscisic acid (ABA) levels, which are important in stress signaling, as seen with other stress-related proteins in Arabidopsis .

  • Biochemical characterization:

    • Assess potential sulfurtransferase activity using recombinant protein and appropriate substrates.

    • Investigate redox state and post-translational modifications under stress conditions.

    • Perform protein-protein interaction studies to identify stress-related interaction partners .

This multi-faceted approach would provide comprehensive insights into STR4A's potential role in plant stress responses, similar to the approach used to characterize other stress-related proteins like STRP in Arabidopsis .

What techniques are most effective for studying protein-protein interactions involving STR4A?

To elucidate STR4A's functional network within chloroplasts, several complementary protein-protein interaction techniques are recommended:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-STR4A antibodies to pull down STR4A and its interacting partners from chloroplast extracts .

    • Analyze co-precipitated proteins by mass spectrometry.

    • Verify interactions by reciprocal Co-IP with antibodies against putative interactors.

    • This approach has been successfully used to identify protein complexes in Arabidopsis stress granules and could be adapted for chloroplastic proteins .

  • Yeast two-hybrid (Y2H) screening:

    • Clone the mature STR4A (without transit peptide) into Y2H bait vectors.

    • Screen against Arabidopsis cDNA libraries or specific candidate interactors.

    • Confirm positive interactions through growth on selective media and reporter gene activation.

    • This system is particularly useful for identifying binary interactions .

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse STR4A and candidate interactors to complementary fragments of fluorescent proteins.

    • Transform protoplasts or generate stable transgenic lines.

    • Visualize interactions through restored fluorescence in chloroplasts.

    • This technique allows visualization of interactions in their native subcellular context .

  • Proximity-dependent biotin identification (BioID):

    • Generate fusions of STR4A with a biotin ligase (e.g., BioID2 or TurboID).

    • Express in Arabidopsis and allow biotinylation of proximal proteins.

    • Purify biotinylated proteins and identify by mass spectrometry.

    • This approach captures both stable and transient interactions in vivo .

  • Proteomics-based approaches:

    • Compare chloroplast protein composition between wild-type and str4a mutant plants.

    • Use DIGE (Difference Gel Electrophoresis) or label-free quantitative proteomics.

    • Identify proteins whose abundance or modification state changes in the absence of STR4A.

    • This approach can reveal functional relationships even without direct physical interactions .

The combination of these techniques provides a comprehensive view of STR4A's interaction network and functional associations within the chloroplast proteome.

How might STR4A function in chloroplast sulfur metabolism and what experimental approaches can test these hypotheses?

As a rhodanese-like domain-containing protein located in chloroplasts, STR4A may play roles in sulfur metabolism and redox regulation. To investigate these potential functions:

  • Hypothesized functions in sulfur metabolism:

    • Sulfurtransferase activity: STR4A may transfer sulfur from donor molecules (like thiosulfate) to acceptor molecules

    • Iron-sulfur cluster assembly: It might participate in the formation of Fe-S clusters needed for photosynthetic electron transport

    • Detoxification of reactive sulfur species: STR4A could help neutralize harmful sulfur compounds produced during stress

    • Mobilization of sulfur during stress: It may facilitate redistribution of sulfur resources when plants face adverse conditions

  • Experimental approaches to test sulfurtransferase activity:

    • In vitro enzyme assays: Use purified recombinant STR4A to measure transfer of sulfur from thiosulfate to cyanide, forming thiocyanate

    • Mass spectrometry: Identify sulfur-containing products formed in reactions catalyzed by STR4A

    • Site-directed mutagenesis: Modify predicted catalytic residues to confirm their role in activity

    • Physiological substrate identification: Use metabolomics to compare sulfur-containing compounds in wild-type and str4a mutants

  • Approaches to study role in Fe-S cluster formation:

    • Iron-sulfur cluster analysis: Measure abundance and integrity of Fe-S clusters in photosystems of str4a mutants

    • Interaction studies: Test for interactions with known Fe-S cluster assembly proteins

    • Electron transport measurements: Assess photosynthetic electron transport efficiency in mutants

  • Methods to investigate redox functions:

    • Redox proteomics: Compare oxidation states of chloroplast proteins between wild-type and str4a mutants

    • ROS measurements: Quantify reactive oxygen species in chloroplasts during stress

    • Antioxidant system analysis: Measure activities of antioxidant enzymes and metabolites in mutants

These approaches would provide comprehensive insights into STR4A's potential functions in chloroplast sulfur metabolism and redox regulation, similar to methods used to characterize other chloroplastic proteins in Arabidopsis .

What approaches should be used to resolve contradictory data when studying STR4A function?

When faced with contradictory results in STR4A functional studies, researchers should consider:

  • Methodological reconciliation:

    • Compare experimental conditions: Minor differences in growth conditions, plant age, or stress application can significantly affect results

    • Standardize protocols: Develop consistent protocols for phenotyping, protein extraction, and activity assays

    • Use multiple independent methods: Confirm findings using complementary approaches (e.g., genetic, biochemical, and imaging techniques)

    • Control for genetic background effects: Ensure all compared lines have the same background or use multiple alleles in different backgrounds

  • Genetic complexity considerations:

    • Functional redundancy: Test for compensatory effects by other rhodanese-domain proteins

    • Generate higher-order mutants: Create double or triple mutants with related genes

    • Conditional knockouts: Use inducible systems to avoid developmental compensation

    • Natural variation: Check if contradictory results correlate with different Arabidopsis ecotypes

  • Data integration approaches:

    • Meta-analysis: Systematically compare results across multiple studies

    • Bayesian inference: Use probabilistic models to integrate conflicting data

    • Systems biology: Place contradictory results in broader network context

    • Computational modeling: Develop models that could explain seemingly contradictory observations under different conditions

  • Technical validation strategies:

    • Independent confirmation: Have different labs replicate key experiments

    • Antibody validation: Confirm specificity using knockout controls

    • Transgene characterization: Verify expression levels and insertion sites

    • Sequencing verification: Confirm CRISPR edits or T-DNA insertions by sequencing

This systematic approach to resolving contradictions has been successfully applied in other Arabidopsis protein studies, including research on stress granule proteins where initial contradictory results were later reconciled through careful methodological standardization and data integration .

How can researchers effectively study the evolutionary conservation and divergence of STR4A compared to homologs in other plant species?

To investigate evolutionary aspects of STR4A across plant species:

  • Comparative genomics approaches:

    • Phylogenetic analysis: Construct phylogenetic trees of rhodanese-domain proteins across diverse plant species

    • Synteny analysis: Examine conservation of genomic regions surrounding STR4A homologs

    • Selection pressure analysis: Calculate dN/dS ratios to identify signatures of positive or purifying selection

    • Domain architecture comparison: Analyze whether domain arrangements are conserved across species

  • Functional conservation assessment:

    • Complementation studies: Test if STR4A homologs from other species can rescue Arabidopsis str4a mutant phenotypes

    • Heterologous expression: Express STR4A in other plant species and assess effects

    • Activity comparisons: Compare biochemical activities of recombinant STR4A proteins from different species

    • Expression pattern analysis: Compare tissue-specific and stress-responsive expression patterns of homologs

  • Structural comparison methods:

    • Homology modeling: Generate structural models of STR4A homologs based on solved structures

    • Conservation mapping: Identify conserved surface patches that might indicate functional sites

    • Molecular dynamics simulations: Compare predicted dynamic properties of homologs

    • Active site comparison: Analyze conservation of catalytic residues across species

  • Systems-level evolutionary analysis:

    • Interactome conservation: Compare protein interaction networks across species

    • Co-evolution analysis: Identify proteins that co-evolve with STR4A homologs

    • Gene co-expression networks: Compare co-expression patterns across species

    • Metabolic context: Analyze whether STR4A homologs operate in similar metabolic pathways across species

This multi-faceted evolutionary analysis would provide insights into STR4A's conserved functions and species-specific adaptations, similar to approaches used for other plant proteins that have been studied across multiple species, as described in the review of Arabidopsis as a model for translational research .

What are the main technical challenges when working with recombinant chloroplastic proteins like STR4A and how can they be overcome?

Researchers working with recombinant chloroplastic proteins face several technical challenges:

  • Solubility and proper folding issues:

    • Challenge: Chloroplastic proteins often misfold or form inclusion bodies when expressed in heterologous systems.

    • Solutions:

      • Express without the transit peptide (positions 61-264 for STR4A)

      • Lower expression temperature (16-18°C)

      • Use solubility-enhancing tags (MBP, SUMO)

      • Add chemical chaperones to expression medium

      • Use chloroplast-specific chaperones as co-expression partners

  • Post-translational modifications:

    • Challenge: Bacterial systems lack plant-specific post-translational modification machinery.

    • Solutions:

      • Use plant-based expression systems for certain applications

      • Perform in vitro modifications after purification

      • Consider insect cell or yeast expression systems as alternatives

      • Use cell-free expression systems supplemented with chloroplast extracts

  • Oxidation sensitivity:

    • Challenge: Many chloroplastic proteins contain redox-sensitive cysteine residues.

    • Solutions:

      • Include reducing agents (DTT, β-mercaptoethanol) in all buffers

      • Work under anaerobic conditions when possible

      • Store proteins with glycerol at -80°C in small aliquots to prevent repeated freeze-thaw cycles

      • Add specific stabilizers based on protein properties

  • Activity reconstitution:

    • Challenge: Purified proteins may lack cofactors or interaction partners needed for activity.

    • Solutions:

      • Supplement activity assays with potential cofactors

      • Reconstitute with chloroplast lipids for membrane-associated proteins

      • Co-express with known interaction partners

      • Include adequate controls to confirm specific activity

  • Storage stability:

    • Challenge: Chloroplastic proteins may lose activity during storage.

    • Solutions:

      • Store in buffer containing 50% glycerol at -20°C for short-term or -80°C for long-term storage

      • Add protein stabilizers (trehalose, sucrose)

      • Lyophilize for extended storage

      • Avoid repeated freeze-thaw cycles by preparing working aliquots

These solutions have been developed based on experience with various chloroplastic proteins and can be adapted specifically for STR4A based on its characteristics.

What quality control measures should be implemented when working with recombinant STR4A?

To ensure reliable results with recombinant STR4A, comprehensive quality control measures are essential:

  • Purity assessment:

    • SDS-PAGE analysis: Ensure ≥85% purity as standard for research applications

    • Size exclusion chromatography: Verify protein homogeneity and absence of aggregates

    • Mass spectrometry: Confirm protein identity and integrity

    • Western blot: Use anti-STR4A antibodies to verify identity

  • Structural integrity verification:

    • Circular dichroism spectroscopy: Assess secondary structure content

    • Thermal shift assay: Determine protein stability and proper folding

    • Limited proteolysis: Evaluate folding quality by resistance to proteolytic digestion

    • Dynamic light scattering: Check for aggregation or oligomerization

  • Functional validation:

    • Activity assays: Measure enzymatic activity using appropriate substrates

    • Binding assays: Test interaction with known partners

    • Comparison with native protein: When possible, compare properties with native protein extracted from Arabidopsis chloroplasts

    • Lot-to-lot consistency: Ensure reproducibility between different preparations

  • Storage quality control:

    • Stability monitoring: Test activity retention after storage

    • Freeze-thaw sensitivity: Determine activity loss after multiple freeze-thaw cycles

    • Temperature sensitivity: Evaluate stability at different temperatures

    • Buffer optimization: Test different buffer compositions for optimal stability

Quality ParameterMethodAcceptable Criteria
PuritySDS-PAGE≥85% single band at 29 kDa
IdentityWestern blot/MSPositive with anti-STR4A antibody; MS confirmation of sequence
HomogeneitySize exclusion>90% monomeric population
FoldingCircular dichroismSpectrum consistent with predicted secondary structure
StabilityThermal shiftSingle, cooperative unfolding transition
ActivityEnzyme assayActivity within 20% of reference standard

Implementing these quality control measures ensures that experimental results with recombinant STR4A are reliable and reproducible across different studies .

What emerging technologies could advance our understanding of STR4A function in Arabidopsis?

Several cutting-edge technologies could significantly enhance STR4A research:

  • Advanced CRISPR-based technologies:

    • Base editing: Create precise amino acid substitutions without double-strand breaks to study structure-function relationships

    • Prime editing: Introduce specific mutations to regulatory regions affecting STR4A expression

    • CRISPR interference/activation: Modulate STR4A expression levels in specific tissues or developmental stages

    • CRISPR screens: Identify genetic interactions by simultaneously targeting STR4A and thousands of other genes

  • Advanced imaging techniques:

    • Super-resolution microscopy: Visualize sub-chloroplastic localization with nanometer precision

    • Single-molecule tracking: Follow individual STR4A molecules in live cells

    • FRET sensors: Develop sensors to monitor STR4A activity or conformational changes in real-time

    • Cryo-electron tomography: Visualize STR4A in its native context within chloroplasts

  • Proteomics innovations:

    • Proximity labeling proteomics: Map STR4A's spatial interactome within chloroplasts

    • Cross-linking mass spectrometry: Identify transient or weak interaction partners

    • Thermal proteome profiling: Detect changes in STR4A stability upon ligand binding

    • Redox proteomics: Map redox-sensitive residues and their modification states

  • Systems biology approaches:

    • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to place STR4A in broader cellular networks

    • Single-cell omics: Analyze cell-specific roles of STR4A across different tissues

    • Machine learning models: Predict STR4A functions from integrated datasets

    • Network analysis: Identify key nodes that connect STR4A to stress response pathways

  • Synthetic biology tools:

    • Optogenetic control: Develop light-controlled STR4A variants to manipulate activity with spatiotemporal precision

    • Biosensors: Create sensors to monitor sulfurtransferase activity in vivo

    • Engineered protein scaffolds: Develop synthetic interaction modules to manipulate STR4A pathways

    • Minimal chloroplasts: Reconstitute STR4A function in simplified systems

These emerging technologies would significantly advance our understanding of STR4A's role in chloroplast biology and plant stress responses, potentially leading to applications in improving crop stress resilience .

How might research on STR4A contribute to broader applications in crop improvement?

Research on STR4A could potentially impact crop improvement through several pathways:

  • Stress tolerance engineering:

    • If STR4A proves important in stress responses, similar to the Salt Tolerance-Related Protein (STRP) , engineering its expression could enhance crop resilience to environmental stresses.

    • Arabidopsis genes have successfully been transferred to crops to improve stress tolerance, as demonstrated with drought tolerance genes .

    • Strategic overexpression or modification of STR4A homologs in crops could enhance chloroplast function under stress conditions.

  • Sulfur metabolism optimization:

    • As a potential sulfurtransferase, STR4A may influence sulfur utilization efficiency.

    • Improved sulfur metabolism could enhance crop nutritional quality and stress resistance.

    • Engineering sulfur partitioning through manipulation of STR4A homologs might improve yield under sulfur-limited conditions.

  • Photosynthetic efficiency:

    • Chloroplastic proteins like STR4A may influence photosynthetic efficiency through roles in maintaining chloroplast function.

    • Even small improvements in photosynthetic efficiency can significantly impact crop yield.

    • Understanding STR4A's role in chloroplast homeostasis could inform strategies to protect photosynthesis under stress.

  • Translational research approaches:

    • Knowledge from Arabidopsis STR4A studies can be directly applied to crop STR4A homologs.

    • As highlighted in recent reviews, Arabidopsis research has successfully led to crop improvements through both direct gene transfer and knowledge-based breeding approaches .

    • The availability of crop genome sequences facilitates identification of STR4A orthologs in important crop species.

  • Genetic resources for breeding programs:

    • Identification of natural variation in STR4A and correlation with stress resilience could provide markers for breeding programs.

    • Understanding the regulatory networks involving STR4A can help identify additional targets for crop improvement.

    • The systematic approaches used to study STR4A in Arabidopsis provide templates for similar studies in crop species.

The study of STR4A exemplifies how fundamental research in Arabidopsis can provide valuable insights that can be translated to crop improvement, following the successful model of other Arabidopsis genes like AtBBX32, which when introduced into soybean increased seed yield .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.