Recombinant Arabidopsis thaliana RING-H2 finger protein ATL11 (ATL11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ATL11; At1g72200; T9N14.11; RING-H2 finger protein ATL11; RING-type E3 ubiquitin transferase ATL11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-404
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL11
Target Protein Sequence
GFKFVAGQATHGGSDVSGDSSRFDPTMAILMIVLVSVFFFLGFFSVYIRRCLERVMGMDY GNPNDAGNWLATNRQQARGLDASIIETFPTFQYSTVKTLRIGKEALECSVCLNEFEDDET LRLIPKCCHVFHPGCIDAWLRSHTTCPLCRADLIPVPGESIVSIQIPGLVNDPPGSDPNG DRIRSLGSPDARLIESVALTCNQSMPRRSMSTGWNLAGMFTNSDRTGQHSENLDRFTLRL PQDIHNKLVNPNLSKVHVALPQVMSSTRGYRTGSLGSERNYFYYERFDQDGRLDRRPFSI TPPYRTSSINHMSPGGSGGDKVRASSPKSLLLAMRSPFDRLFLGKNNNVGENSSDHLRSC DATPSNTV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G72200

STRING: 3702.AT1G72200.1

UniGene: At.35131

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL family of proteins and how is ATL11 classified?

The ATL (Arabidopsis Tóxicos en Levadura) family comprises single-subunit RING finger E3 ubiquitin ligases that contain substrate recognition sequences in the same polypeptide . These proteins are characterized by a transmembrane domain and a RING-H2 finger domain, without any other previously described domains . ATL11 belongs to this family and is specifically encoded by the gene At1g72200 in Arabidopsis thaliana . The ATL family includes at least 80 members in Arabidopsis, all sharing the distinctive RING-H2 domain with six cysteines and two histidines that coordinate zinc ligation with precisely conserved spacing .

What is the structural composition of the ATL11 protein?

ATL11 features the characteristic RING-H2 finger domain, which contains the canonical arrangement of six cysteines and two histidines that coordinate zinc binding . The protein also contains a transmembrane domain located near the amino-terminus and likely possesses the conserved GLD motif (a 12-16 amino acid sequence often beginning with glycine, leucine, and aspartic acid residues) between the transmembrane helices and the RING-H2 domain . The complete amino acid sequence of ATL11 as provided in the product information shows a protein of significant complexity with multiple functional domains essential for its biological activity .

How does the RING-H2 domain function in ubiquitination?

The RING-H2 domain in ATL11 functions as the catalytic core for its E3 ubiquitin ligase activity . This domain facilitates the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to specific target proteins, thereby marking them for degradation by the 26S proteasome . The specific arrangement of the six cysteines and two histidines creates a structure that coordinates zinc ions, which is critical for the domain's function . Additionally, the domain contains a conserved tryptophan residue located three residues downstream from the sixth zinc ligand, a feature that is invariable in most RING finger domains and likely important for structural stability or protein-protein interactions .

What are the optimal storage and handling conditions for recombinant ATL11?

Recombinant ATL11 protein requires specific storage conditions to maintain its stability and activity. According to product specifications, the protein should be stored at -20°C, with extended storage possible at either -20°C or -80°C . It is crucial to avoid repeated freezing and thawing cycles as these can lead to protein denaturation and loss of activity . For ongoing experiments, working aliquots can be stored at 4°C for up to one week . The protein is typically provided in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for ATL11 stability . Proper adherence to these storage recommendations ensures the maintenance of protein integrity and enzymatic activity for experimental use.

How can researchers design experiments to identify ATL11 substrates?

Identifying substrates of E3 ubiquitin ligases like ATL11 requires a multi-faceted experimental approach. Based on successful strategies with other ATL family members, researchers should consider:

  • Yeast Two-Hybrid Screening: This approach has successfully identified substrates for other ATL proteins, such as ABT1 for ATL5 . The RING-H2 domain can be used as bait to screen Arabidopsis cDNA libraries.

  • Bimolecular Fluorescence Complementation (BiFC): This technique confirms protein interactions in planta and provides information about subcellular localization of the interaction .

  • Co-immunoprecipitation Analysis: This method validates protein interactions under native conditions and can be coupled with western blotting or mass spectrometry to confirm substrate identity .

  • In Vitro and In Vivo Ubiquitination Assays: These assays demonstrate direct ubiquitination of potential substrates by ATL11. The in vitro system typically includes recombinant E1, E2, ATL11, ubiquitin, ATP, and the candidate substrate .

  • Proteomic Approaches: Comparing ubiquitinated protein profiles between wild-type and ATL11 mutant plants can reveal potential substrates, especially when combined with proteasome inhibitors to prevent degradation of ubiquitinated proteins .

What genetic approaches are most effective for studying ATL11 function in Arabidopsis?

Several genetic approaches can be employed to elucidate ATL11 function in Arabidopsis:

  • T-DNA Insertion Lines/CRISPR-Cas9 Knockouts: Creating and characterizing knockout mutants provides insights into the phenotypic consequences of ATL11 loss . This approach revealed the seed longevity defect in atl5 mutants, for example .

  • Complementation Studies: Reintroducing ATL11 into knockout lines confirms that observed phenotypes are specifically due to ATL11 loss. This was demonstrated with ATL5, where expressing ATL5 in atl5-2 mutants restored the defective seed longevity phenotype .

  • Overexpression Lines: Creating transgenic lines that overexpress ATL11 can reveal gain-of-function phenotypes and potential dosage effects .

  • Domain Mutagenesis: Introducing specific mutations in functional domains (e.g., the RING-H2 domain) can help dissect the importance of these domains for ATL11 function.

  • Reporter Gene Fusions: Fusing the ATL11 promoter with reporter genes like GUS or GFP helps visualize its expression patterns across tissues and developmental stages .

  • Double Mutant Analysis: Crossing ATL11 mutants with mutants of interacting partners or related pathways can reveal genetic interactions and pathway positioning .

How does ATL11 compare functionally with other ATL family members?

While specific functional data on ATL11 is limited in the provided search results, comparative analysis with other ATL family members provides valuable insights:

ATL Family MemberKnown FunctionSubstrate(s)Expression PatternReference
ATL5Positively regulates seed longevityABT1Highly expressed in seed embryos; induced by accelerated aging
ATL11Not specifically determinedUnknownNot specified
RIN2/RIN3Involved in plant immune responsesInteract with RPM1 (disease resistance protein)Not specified
OsRHC1 (rice)Enhances defense responseUnknownNot specified

This comparison suggests that while ATL family members share structural similarities, they likely have diversified to regulate different biological processes . Some members like RIN2/RIN3 and OsRHC1 are implicated in plant immune responses, while ATL5 functions in seed biology . Given the structural conservation, ATL11 may function in similar processes, but this requires experimental verification.

How can researchers address challenges in analyzing ATL11 protein-protein interactions?

Analyzing protein-protein interactions involving membrane-associated E3 ligases like ATL11 presents several challenges that can be addressed through methodological refinements:

  • Transient Interaction Challenge: E3-substrate interactions are often transient and difficult to capture. Solution: Use crosslinking agents or proximity-based labeling techniques like BioID or TurboID to capture transient interactions .

  • Membrane Protein Solubilization: The transmembrane domain of ATL11 complicates protein extraction. Solution: Optimize detergent conditions (e.g., using mild detergents like digitonin or DDM) or express soluble domains separately for interaction studies .

  • Substrate Degradation: Ubiquitinated substrates are rapidly degraded. Solution: Use proteasome inhibitors (e.g., MG132) during extraction and employ degradation-resistant substrate mutants (with lysine to arginine substitutions) .

  • Distinguishing Direct from Indirect Interactions: Solution: Combine multiple complementary approaches (Y2H, BiFC, Co-IP) and include in vitro binding assays with purified components .

  • Data Analysis Complexity: Solution: Implement quantitative interaction scoring systems and use appropriate statistical methods to distinguish significant interactions from background .

What bioinformatic approaches help predict ATL11 substrates and functions?

Several bioinformatic approaches can aid in predicting ATL11 substrates and functions:

  • Sequence-Based Substrate Motif Analysis: Analyze known E3-substrate pairs to identify recognition motifs, then scan the proteome for these motifs to predict potential ATL11 substrates.

  • Co-expression Network Analysis: Genes co-expressed with ATL11 across various conditions may function in the same biological pathways or be potential substrates .

  • Protein-Protein Interaction Network Analysis: Integrating existing protein interaction databases can reveal potential ATL11 interactors and position it within cellular networks .

  • Phylogenetic Analysis: Comparing ATL11 with functionally characterized ATL family members across species can provide insights into its potential functions based on evolutionary conservation .

  • Structural Modeling: Predicting the three-dimensional structure of ATL11 and performing molecular docking simulations with potential substrates can suggest binding mechanisms.

  • Gene Ontology Enrichment Analysis: Analyzing the functional categories enriched among predicted interactors can suggest biological processes involving ATL11.

How do environmental stresses affect ATL11 expression and activity?

While the search results don't provide specific information about ATL11 response to stresses, research on other ATL family members provides a framework for investigation:

  • Stress-Responsive Expression: Other ATL family members show stress-responsive expression patterns. For instance, ATL5 expression is induced by accelerated aging in seeds , suggesting ATL family proteins may generally respond to stress conditions.

  • Potential Methodological Approach: Researchers should monitor ATL11 expression under various abiotic stresses (drought, salt, heat, cold) and biotic stresses (pathogen infection) using qRT-PCR or reporter gene fusions .

  • Post-translational Regulation: Beyond transcriptional changes, ATL11 activity might be regulated post-translationally under stress conditions, potentially through phosphorylation or other modifications affecting its E3 ligase activity.

  • Substrate Specificity Changes: Environmental stresses might alter ATL11 substrate specificity, directing the ubiquitination machinery toward stress-relevant targets. This can be assessed through comparative proteomics under normal versus stress conditions .

  • Functional Significance: Comparing stress responses between wild-type and ATL11 mutant plants would reveal the functional significance of ATL11 in stress adaptation .

What is the mechanistic relationship between ATL11 and the plant immune system?

The ATL family has established connections to plant immunity, providing context for investigating ATL11's potential role:

  • ATL Family Precedent: Several ATL family members function in plant immunity. RIN2 and RIN3 interact with the RPM1 disease resistance protein, while OsRHC1 enhances defense responses when expressed in Arabidopsis .

  • Ubiquitination in Immune Signaling: The ubiquitin-proteasome system plays crucial roles in regulating immune receptor stability, signaling component turnover, and defense hormone signaling .

  • Hypothetical Mechanism: ATL11 may ubiquitinate negative regulators of immunity, targeting them for degradation, thus promoting defense responses. Alternatively, it might regulate the stability of pattern recognition receptors or downstream signaling components .

  • Experimental Approach: Researchers should assess ATL11 expression during pathogen challenge, examine the disease phenotypes of ATL11 mutants against various pathogens, and identify immunity-related proteins that interact with ATL11 .

  • Signaling Pathway Integration: Investigation of how ATL11 activity integrates with established immune signaling pathways (e.g., salicylic acid, jasmonic acid, or MAPK cascades) would provide mechanistic insights .

How does the membrane localization of ATL11 influence its substrate specificity?

The transmembrane domain of ATL11 likely plays crucial roles in determining its function and substrate specificity:

  • Spatial Restriction: The membrane localization restricts ATL11 to ubiquitinate substrates that are either membrane-associated or transiently interact with membranes .

  • Compartmentalization: Determining the specific membrane where ATL11 localizes (plasma membrane, ER, Golgi, etc.) is crucial for understanding its biological context and potential substrates .

  • Mechanism of Action: The transmembrane domain may position the RING-H2 domain in a specific orientation relative to the membrane, creating a microenvironment that favors interaction with particular substrate proteins .

  • Experimental Approach: Researchers should use fluorescent protein fusions to determine ATL11's precise subcellular localization, and create chimeric proteins by swapping the transmembrane domain with those from other ATL family members to assess changes in substrate specificity .

  • Comparative Analysis: By comparing the substrates of ATL11 with those of other ATL family members that localize to different membranes, researchers can determine how membrane localization influences substrate selection .

What emerging technologies would advance ATL11 research?

Several cutting-edge technologies could significantly advance our understanding of ATL11 function:

  • Proximity-based Labeling: Techniques like BioID, TurboID, or APEX2 fused to ATL11 would allow in vivo identification of proteins that come into close proximity with ATL11, potentially revealing both substrates and interacting partners .

  • CRISPR-Cas9 Base Editing: This allows for precise modification of specific amino acids in ATL11 without introducing double-strand breaks, enabling detailed structure-function studies of critical residues in the RING-H2 domain .

  • Single-molecule Tracking: This could reveal the dynamics of ATL11 movement within membranes and potential clustering during substrate recognition and ubiquitination.

  • Cryo-electron Microscopy: Structural determination of ATL11 in complex with E2 enzymes and substrates would provide unprecedented insights into its mechanism of action.

  • Quantitative Ubiquitinomics: Advanced mass spectrometry approaches that quantify changes in the ubiquitinome between wild-type and ATL11 mutant plants would comprehensively identify ATL11 substrates .

  • Synthetic Biology Approaches: Engineered ATL11 variants with altered substrate specificity could help dissect the molecular determinants of substrate recognition.

How might ATL11 function contribute to agricultural applications?

Understanding ATL11 function could have several agricultural implications:

  • Stress Tolerance: If ATL11 regulates stress responses like some other ATL family members, manipulating its expression might enhance crop resilience to environmental stresses .

  • Pathogen Resistance: Given the involvement of some ATL proteins in immunity, ATL11 manipulation might improve disease resistance in crops .

  • Seed Quality: If ATL11 functions similarly to ATL5 in regulating seed longevity, it could be targeted to improve seed storage properties in important crop species .

  • Biotechnological Applications: Engineering ATL11 variants with novel substrate specificities could allow selective degradation of proteins of interest in crops.

  • Developmental Regulation: If ATL11 regulates specific developmental processes, its manipulation could potentially influence traits like flowering time, fruit development, or senescence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.