Recombinant Arabidopsis thaliana RING-H2 finger protein ATL14 (ATL14)

What is the molecular structure of ATL14 and how does it compare to other ATL family members?

ATL14 (UniProt: Q9M0C3) is a RING-H2 finger protein from Arabidopsis thaliana with a full protein length expression region of 1-176 amino acids . Like other ATL family members, it contains a transmembrane domain at the N-terminal region and a RING-H2 finger domain, which is a variation of the canonical RING finger where the fifth cysteine residue is replaced by a histidine . The protein's amino acid sequence is:

MSITIPYDGSISREPSPSPPPPKANTKNLPTKILSNFLIGLIMIPVAITAFIFILTSLGFTFFFAFYWFLQRNYRHRLRRHRRHEYSDGLSPRCVKRLPQFKYCEPSSEYGGDDCVVCIDGFRQGQWCRKLPRCGHVFHRKCVDLWLIKVSTCPICRDRVYRFEEGRRWRPQGEIF

The gene is located at locus At4g30370 (ORF Name: F17I23.290) . In comparison with other ATL family members, ATL14 shares the conserved RING-H2 domain structure but may differ in the regions between domains, particularly at the carboxy-terminus following the RING-H2 domain, which shows the most size variability across ATL proteins .

What experimental approaches are recommended for expression and purification of recombinant ATL14?

For successful expression and purification of recombinant ATL14, researchers should consider the following methodological approach:

• Expression System Selection: E. coli is commonly used for recombinant ATL protein expression, though consideration should be given to using plant-based expression systems for proper post-translational modifications.

• Vector Design: Include appropriate tags to facilitate purification while ensuring minimal interference with protein function. The tag type should be determined during the production process to optimize for ATL14 specifically .

• Purification Strategy:

  • Utilize affinity chromatography based on the selected tag

  • Follow with size-exclusion chromatography to ensure high purity

  • Consider ion-exchange chromatography as an additional purification step

• Storage Protocol: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, though repeated freezing and thawing should be avoided .

• Quality Control: Verify protein integrity through SDS-PAGE, Western blotting, and functional assays for ubiquitin ligase activity.

How can researchers effectively analyze ATL14 expression patterns in plant tissues?

To analyze ATL14 expression patterns effectively, researchers should employ multiple complementary approaches:

• Transcriptome Analysis:

  • qRT-PCR using gene-specific primers for ATL14

  • RNA-Seq analysis across different tissues and developmental stages

  • Northern blotting for mRNA visualization

• Protein Detection Methods:

  • Western blotting using antibodies raised against recombinant ATL14

  • Immunohistochemistry to visualize tissue-specific localization

• Promoter Analysis:

  • Generation of promoter-reporter fusion constructs (e.g., ATL14 promoter:GUS or ATL14 promoter:GFP)

  • Analysis of promoter activity in response to different stimuli

• Considerations for ATL Protein Expression Analysis:

  • Many ATL transcripts have short half-lives (as demonstrated for ATL2)

  • Expression may be rapidly induced in response to stimuli and then quickly decline

  • Use cycloheximide treatment to determine if expression is independent of de novo protein synthesis

What approaches should be used to investigate ATL14's E3 ligase activity and substrate specificity?

Investigating ATL14's E3 ligase activity and substrate specificity requires sophisticated biochemical and molecular approaches:

• In Vitro Ubiquitination Assay:

  • Reconstitute the ubiquitination reaction using purified components: E1, E2 (preferably from the Ubc4/Ubc5 subfamily based on ATL family preferences) , recombinant ATL14, ubiquitin, ATP, and potential substrates

  • Analyze ubiquitination products by Western blotting or mass spectrometry

  • Include controls with mutated RING-H2 domain to confirm specificity

• E2 Enzyme Identification:

  • Test interaction with multiple E2 enzymes, particularly focusing on the Ubc4/Ubc5 subfamily which has been shown to work with other ATL proteins

  • Perform yeast two-hybrid or pull-down assays to confirm direct interactions

  • Conduct comparative activity assays with different E2 partners

• Substrate Identification Strategies:

  • Yeast two-hybrid screening using ATL14 as bait (excluding the transmembrane domain)

  • Co-immunoprecipitation followed by mass spectrometry

  • Protein arrays to screen for potential interactors

  • Proximity-dependent biotin identification (BioID) in planta

• Validation of Putative Substrates:

  • In vitro ubiquitination assays with identified candidates

  • In vivo co-expression studies to observe substrate degradation

  • Analysis of substrate levels in ATL14 overexpression and knockout lines

• Structure-Function Studies:

  • Generate point mutations in key residues of the RING-H2 domain to identify amino acids critical for E2 binding and catalytic activity

  • Use NMR spectroscopy to determine the three-dimensional structure of the RING-H2 domain, as has been done for other ATL proteins like rice EL5

How can researchers effectively generate and characterize ATL14 loss-of-function and gain-of-function mutants?

Generating and characterizing ATL14 mutants requires careful experimental design:

• Loss-of-Function Strategies:

  • CRISPR/Cas9-mediated gene editing targeting the ATL14 coding sequence

  • T-DNA insertion mutant isolation and characterization

  • RNAi or antisense approaches for knockdown studies

  • TILLING (Targeting Induced Local Lesions IN Genomes) for point mutations

• Gain-of-Function Approaches:

  • Overexpression under constitutive (35S) or inducible promoters

  • Domain swapping with other ATL family members to investigate functional conservation

  • Expression of constitutively active versions (e.g., mutations that enhance E3 ligase activity)

• Phenotypic Characterization:

  • Comprehensive growth analysis under various conditions

  • Stress response assays (biotic and abiotic)

  • Developmental timing and morphological analysis

  • Molecular phenotyping (transcriptomics, proteomics, metabolomics)

• Complementation Studies:

  • Rescue of loss-of-function phenotypes with wild-type ATL14

  • Structure-function analysis using domain deletion or point mutation variants

• Specific Considerations for ATL14:

  • Monitor defense-related phenotypes, as many ATL family members participate in defense responses

  • Examine developmental transitions, as ATLs have been implicated in regulating processes like flowering and post-germinative growth

  • Investigate potential involvement in carbon/nitrogen response regulation

What are the most effective techniques for studying ATL14 membrane localization and dynamics?

As a transmembrane RING-H2 protein, ATL14's localization and dynamics require specialized approaches:

• Subcellular Localization:

  • Fluorescent protein fusions (ensuring tag position doesn't disrupt membrane insertion)

  • Immunolocalization with specific antibodies

  • Cell fractionation followed by Western blotting

  • Confocal microscopy for detailed localization studies

• Membrane Dynamics Analysis:

  • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

  • Pulse-chase experiments to determine protein turnover rates

  • Bimolecular fluorescence complementation (BiFC) to visualize protein-protein interactions in membrane contexts

• Topology Determination:

  • Protease protection assays to identify cytosolic versus luminal domains

  • Glycosylation mapping to determine luminal exposure

  • Epitope insertion and accessibility assays

• Structural Analysis Considerations:

  • Focus on the N-terminal region that typically contains hydrophobic transmembrane helices in ATL proteins

  • Analyze the GLD motif (12-16 amino acids that often begins with glycine, leucine, and aspartic acid) which is located between the transmembrane helices and the RING-H2 domain in ATL proteins

  • Consider that most ATLs contain three or fewer transmembrane helices

How can ATL14 research be integrated with plant stress response studies?

Many ATL family members play crucial roles in plant stress responses, particularly defense against pathogens . Researchers should consider these approaches when connecting ATL14 to stress response studies:

• Expression Analysis Under Stress Conditions:

  • Examine ATL14 transcript and protein levels in response to various biotic stresses (pathogens, PAMPs) and abiotic stresses (drought, salt, temperature)

  • Monitor the timing of expression, noting that many ATLs show early and transient responses to stimuli

  • Compare with known stress-responsive ATLs such as ATL2, which is induced by chitin and other elicitors

• Signaling Pathway Integration:

  • Investigate ATL14 expression in signaling pathway mutants (e.g., hormone signaling, MAPK cascades)

  • Perform epistasis analysis with known stress signaling components

  • Identify upstream transcription factors that regulate ATL14 expression during stress

• Stress-Specific Phenotypic Analysis:

  • Compare response of ATL14 mutants to various pathogens and abiotic stresses

  • Measure defense-related metabolites and gene expression

  • Analyze changes in reactive oxygen species production and cell death

• Comparative Studies with Other ATL Members:

  • Determine functional redundancy with other ATLs in stress responses

  • Create higher-order mutants if necessary to overcome genetic redundancy

  • Compare substrate specificity in stress-related pathways

What considerations should be addressed when studying ATL14 evolutionary conservation and divergence?

Understanding the evolutionary context of ATL14 requires comparative genomic and functional approaches:

• Phylogenetic Analysis Methodology:

  • Identify ATL14 orthologs across plant species using reciprocal BLAST searches

  • Construct phylogenetic trees using both full-length protein sequences and individual domains

  • Compare with the broader ATL family evolutionary patterns, which has been classified into 9 groups based on phylogeny and motif organization

• Sequence Conservation Analysis:

  • Examine conservation of key functional domains (RING-H2 finger, transmembrane region)

  • Identify species-specific adaptations in sequence and domain architecture

  • Analyze selection pressures on different regions of the protein

• Synteny and Gene Duplication Analysis:

  • Investigate chromosomal context of ATL14 orthologs across species

  • Determine if ATL14 belongs to any tandemly arrayed ATL clusters, which are common in many plant species

  • Analyze whole genome duplication events and their impact on ATL14 evolution

• Functional Conservation Testing:

  • Perform cross-species complementation studies

  • Compare substrate specificity of ATL14 orthologs

  • Analyze expression patterns of orthologs in different plant lineages

What methodological approaches are recommended for investigating ATL14 involvement in protein quality control and cellular homeostasis?

As a transmembrane E3 ligase, ATL14 may function in protein quality control systems:

• Endoplasmic Reticulum-Associated Degradation (ERAD) Involvement:

  • Test for colocalization with ER markers

  • Analyze interactions with known ERAD components

  • Examine degradation of known ERAD substrates in ATL14 mutants

  • Assess ER stress responses in ATL14 mutant plants

• Stress Granule and Processing Body Association:

  • Investigate colocalization with stress granule and P-body markers under stress conditions

  • Test for genetic interactions with RNA processing machinery

  • Analyze mRNA turnover rates in ATL14 mutants

• Proteostasis Network Integration:

  • Perform global proteomics in ATL14 mutants to identify accumulated proteins

  • Analyze changes in ubiquitination patterns using ubiquitin remnant profiling

  • Test genetic interactions with components of other protein quality control pathways

  • Measure sensitivity to proteotoxic stress (e.g., heat shock, chemical stress)

• Autophagy Pathway Connections:

  • Assess autophagy markers in ATL14 mutant backgrounds

  • Test for interactions with autophagy-related proteins

  • Examine selective autophagy processes for potential ATL14 involvement

How can researchers overcome challenges in detecting and measuring ATL14 ubiquitination activity?

E3 ubiquitin ligase activity detection presents several technical challenges that researchers should address:

• Low Abundance and Rapid Turnover Issues:

  • Use inducible expression systems to control protein levels

  • Apply proteasome inhibitors (MG132) to prevent degradation of ubiquitinated proteins

  • Employ sensitive detection methods like mass spectrometry-based approaches

• Specific Activity Measurement Approaches:

  • In vitro autoubiquitination assays using purified components

  • Develop substrate-specific ubiquitination assays once targets are identified

  • Use a combination of free and tagged ubiquitin to distinguish different ubiquitin chain topologies

  • UbiCREST assay (Ubiquitin Chain Restriction Analysis) to determine chain linkage types

• Controls and Validations:

  • Include RING-H2 domain mutants as negative controls

  • Verify E2 dependency using E2 variants with catalytic site mutations

  • Confirm ATP-dependence of reactions

  • Validate findings with in vivo approaches such as cell-free degradation assays

• Advanced Detection Methods:

  • Proximity ligation assays to visualize ubiquitination events in situ

  • TUBE (Tandem Ubiquitin Binding Entities) for enrichment of ubiquitinated proteins

  • Use of linkage-specific antibodies to determine ubiquitin chain topology

What are effective strategies for addressing functional redundancy when studying ATL14?

The ATL family in Arabidopsis thaliana contains approximately 80 members , creating significant challenges in assigning specific functions to individual proteins like ATL14:

• Higher-Order Mutant Generation:

  • Create double, triple, or higher-order mutants of phylogenetically related ATLs

  • Use CRISPR/Cas9 multiplexing to target multiple ATLs simultaneously

  • Consider inducible amiRNA approaches targeting conserved regions of related ATLs

• Expression Pattern Analysis:

  • Identify spatiotemporal overlap in expression of ATL14 and related family members

  • Focus functional studies on tissues or conditions where ATL14 is uniquely or predominantly expressed

  • Use single-cell RNA-seq to identify cell types with specific ATL14 expression

• Domain Swapping and Chimeric Protein Approaches:

  • Create chimeric proteins between ATL14 and related ATLs to identify domains responsible for specific functions

  • Perform targeted mutagenesis of residues unique to ATL14

  • Use substrate-binding domain swaps to investigate specificity

• Comparative Biochemical Characterization:

  • Side-by-side analysis of substrate specificity for related ATLs

  • Determine E2 preferences for different ATL family members

  • Analyze ubiquitin chain types produced by different ATLs

What methodological considerations are important when interpreting phenotypes of ATL14 mutants?

Interpreting phenotypes from ATL14 mutants requires careful experimental design and controls:

• Genetic Background Considerations:

  • Use multiple independent mutant alleles to confirm phenotypes

  • Perform complementation with the native ATL14 gene to verify phenotype causality

  • Consider ecotype-specific effects, as ATL functions may vary between Arabidopsis ecotypes

• Pleiotropic Effect Analysis:

  • Distinguish direct from indirect effects through time-course and tissue-specific studies

  • Use inducible systems to control the timing of ATL14 manipulation

  • Perform comprehensive phenotyping across development and stress conditions

• Environmental Condition Controls:

  • Standardize growth conditions rigorously, as ATL responses may be condition-dependent

  • Test phenotypes under multiple environmental conditions

  • Consider circadian and diurnal regulation, as some ATLs show time-of-day dependent functions

• Molecular Mechanism Validation:

  • Connect phenotypes to molecular changes (transcriptome, proteome)

  • Identify and validate direct substrates related to observed phenotypes

  • Perform rescue experiments with modified versions of ATL14 to link specific molecular functions to phenotypes

How might emerging technologies advance our understanding of ATL14 function?

Several cutting-edge technologies offer promising approaches for deepening our understanding of ATL14:

• Proximity Labeling Technologies:

  • TurboID or miniTurboID fusions to identify nearby proteins in the native cellular environment

  • APEX2-based proximity labeling for temporal control of interaction mapping

  • Split-BioID systems to capture conditional interactions

• Advanced Imaging Approaches:

  • Super-resolution microscopy to visualize membrane domain localization

  • Single-molecule tracking to study dynamics in living cells

  • Optogenetic tools to control ATL14 activity with spatial and temporal precision

• Structural Biology Innovations:

  • Cryo-EM analysis of ATL14 in membrane environments

  • Integrative structural modeling combining multiple data sources

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein regions

• Single-Cell Multi-Omics:

  • Single-cell transcriptomics to identify cell-specific functions

  • Spatial transcriptomics to map expression patterns at high resolution

  • Combined single-cell proteomics and transcriptomics to correlate protein and mRNA levels

What interdisciplinary approaches could reveal new insights about ATL14's role in plant biology?

Interdisciplinary research offers unique opportunities to uncover novel aspects of ATL14 function:

• Systems Biology Integration:

  • Network modeling to place ATL14 in broader cellular pathways

  • Multi-omics integration (transcriptomics, proteomics, metabolomics, phenomics)

  • Machine learning approaches to predict ATL14 functions from large datasets

• Synthetic Biology Applications:

  • Engineer synthetic regulatory circuits incorporating ATL14

  • Create orthogonal ubiquitination systems to study ATL14 in isolation

  • Develop biosensors for ATL14 activity in vivo

• Evolutionary and Ecological Perspectives:

  • Field studies to assess ATL14 function under natural conditions

  • Comparative analysis across diverse plant species and environments

  • Study of natural variation in ATL14 sequence and function

• Computational Biology Approaches:

  • Molecular dynamics simulations of ATL14 in membrane environments

  • Deep learning models to predict substrate recognition

  • Protein design approaches to engineer novel ATL14 functionalities