Recombinant Arabidopsis thaliana RING-H2 finger protein ATL18 (ATL18)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

ATL18 is a cytosolic protein (UniProt ID: Q9SZL4) expressed in E. coli with an N-terminal His tag for purification . Key features include:

PropertyDetail
Amino Acid SequenceKKNGGDADAHDDDGYNLVGVMFGDKEKEEEICCPICLVEFEAEDAVTHLPRCAHLFHINCIEPWLLRGHLTCPLCRSFVLAPTPPTQNVNNAHSSSTLYLSIFFFFCIFLHLLGYL
Protein Length116 residues (30–145aa of mature protein)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C

Biological Function

ATL18 functions as a RING-H2-type E3 ubiquitin transferase, facilitating substrate ubiquitination in coordination with E2 conjugases . Key roles include:

  • Sulfur Trafficking: Forms a cytosolic sulfur relay system with ABA3 (a cysteine desulfurase), enabling transpersulfidation reactions critical for sulfur-containing metabolite biosynthesis .

  • Ubiquitination: Mediates protein degradation via the 26S proteasome, influencing stress response pathways .

Interaction with ABA3

ATL18 interacts with ABA3 in planta, as demonstrated by split-luciferase assays :

  • Mechanism: STR18 (ATL18’s Rhd domain) reduces persulfide intermediates on ABA3, accelerating sulfur transfer .

  • Catalytic Residues: Cys89 in STR18 is essential for sulfurtransferase (TST) activity, while Cys47 is dispensable .

Enzymatic Activity

  • Turnover Rate: STR18 doubles ABA3’s cysteine desulfuration rate (0.66 → 1.39 mol sulfur mol⁻¹ enzyme min⁻¹) .

  • Substrate Specificity: Prefers l-cysteine over thiosulfate as a sulfur donor .

Experimental Applications

ATL18 is utilized in:

  • Transpersulfidation Assays: Monitored using redox-sensitive roGFP2 to track sulfur transfer efficiency .

  • Ubiquitination Studies: Investigated via in vitro assays with E2 conjugases (e.g., Ubc8) .

Evolutionary Context

ATL18 belongs to a subgroup of 11 A. thaliana ATLs with conserved hydrophobic and RING-H2 domains, likely arising from gene duplication events . Functional redundancy is observed in tandemly duplicated genes (e.g., ATL31) .

Unresolved Questions

  • Substrates: Specific ubiquitination targets of ATL18 remain unidentified.

  • Stress Pathways: Role in abiotic/biotic stress responses warrants further study.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
ATL18; At4g38140; F20D10.260; RING-H2 finger protein ATL18; RING-type E3 ubiquitin transferase ATL18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-145
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL18
Target Protein Sequence
KKNGGDADAHDDDGYNLVGVMFGDKEKEEEICCPICLVEFEAEDAVTHLPRCAHLFHINC IEPWLLRGHLTCPLCRSFVLAPTPPTQNVNNAHSSSTLYLSIFFFFCIFLHLLGYL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G38140

STRING: 3702.AT4G38140.1

UniGene: At.64216

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is ATL18 different from similarly named proteins in Arabidopsis?

It's important to distinguish ATL18 from similarly named proteins such as AtAGP18, which is a lysine-rich arabinogalactan protein involved in plant growth and development as a putative co-receptor for signal transduction . While both are Arabidopsis proteins, they belong to different protein families with distinct functions—ATL18 functions as an E3 ubiquitin ligase in protein degradation pathways, whereas AtAGP18 is a cell surface glycoprotein involved in developmental signaling .

What cellular processes is ATL18 involved in?

As a RING-type E3 ubiquitin transferase, ATL18 likely plays roles in protein ubiquitination, marking specific proteins for degradation through the 26S proteasome. Based on its classification, it may be involved in various cellular processes including stress responses, hormone signaling, developmental regulation, or pathogen defense, though specific pathways have not been fully characterized in the available research .

What are the optimal conditions for expressing recombinant ATL18?

Recombinant ATL18 has been successfully expressed in E. coli as a His-tagged protein containing amino acids 30-145 of the mature protein . For optimal expression:

  • Use an N-terminal His-tag fusion construct

  • Express in E. coli under standard induction conditions

  • Consider temperature optimization (typically 16-25°C) to improve solubility

  • Include protease inhibitors during cell lysis to prevent degradation

The exclusion of the first 29 amino acids in the recombinant construct suggests these may represent a signal peptide or a region that could interfere with proper folding or solubility .

What purification strategy yields the highest purity and activity of ATL18?

Based on available protocols, the following purification strategy is recommended:

  • Initial capture using Ni-NTA affinity chromatography targeting the His-tag

  • Buffer optimization with Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

  • Consider including reducing agents (e.g., DTT or β-mercaptoethanol) to maintain the integrity of the RING-H2 domain

  • Further purification using size exclusion chromatography if higher purity is required

Careful attention to buffer composition is critical as RING finger proteins require proper zinc coordination for structural integrity and catalytic activity.

How should researchers store purified ATL18 to maintain its activity?

For optimal storage of recombinant ATL18:

  • Short-term storage: Keep at 4°C for up to one week

  • Long-term storage: Store at -20°C/-80°C

  • Add glycerol to a final concentration of 5-50% (50% recommended)

  • Aliquot before freezing to minimize freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

What experimental approaches can verify ATL18's E3 ligase activity?

To assess ATL18's E3 ubiquitin ligase activity:

  • In vitro ubiquitination assay: Combine purified ATL18 with E1 enzyme, appropriate E2 conjugating enzyme, ubiquitin, ATP, and potential substrates. Monitor ubiquitin chain formation by western blotting.

  • Auto-ubiquitination assay: Examine ATL18's ability to ubiquitinate itself in the absence of substrate, which is common for many RING-type E3 ligases.

  • Control experiments:

    • Negative controls: Reactions lacking ATP, E1, E2, or using RING domain mutants

    • Positive controls: Well-characterized E3 ligases with known activity

  • Quantification: Use densitometry analysis of western blots to quantify ubiquitination levels and perform statistical analysis across multiple independent experiments.

How can researchers identify potential substrates of ATL18?

Multiple complementary approaches can be employed to identify ATL18 substrates:

  • Yeast two-hybrid (Y2H) screening using ATL18 as bait against an Arabidopsis cDNA library

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged ATL18 in Arabidopsis

    • Immunoprecipitate protein complexes

    • Identify interacting proteins by mass spectrometry

  • Differential proteomics comparing wild-type and ATL18 mutant plants:

    • Proteins that accumulate in ATL18 mutants may represent potential substrates

    • Focus on proteins that show ubiquitination differences between genotypes

  • Validation through in vitro and in vivo ubiquitination assays with candidate substrates

How can single-cell approaches advance our understanding of ATL18 function?

Recent advances in single-cell technologies offer new opportunities to study ATL18 function with unprecedented resolution:

  • Single-cell ATAC-seq can reveal cell type-specific chromatin accessibility at the ATL18 locus or at genes regulated by ATL18-dependent pathways . This approach has been successfully applied to Arabidopsis roots to identify thousands of differentially accessible sites across different cell types .

  • Single-cell RNA-seq can identify:

    • Cell types where ATL18 is preferentially expressed

    • Genes co-expressed with ATL18 in specific cell populations

    • Transcriptional changes in response to ATL18 perturbation with cell type resolution

  • Integration of single-cell transcriptomics and chromatin accessibility data can help construct gene regulatory networks involving ATL18, particularly for developmental processes where ATL18 may play context-dependent roles .

What are the challenges in distinguishing ATL18 functions from other ATL family members?

The Arabidopsis genome encodes multiple ATL family members with potentially overlapping functions, presenting several research challenges:

  • Functional redundancy:

    • Single mutants may exhibit subtle or no phenotypes

    • Consider generating higher-order mutants of closely related ATL genes

    • Use inducible or tissue-specific silencing to bypass developmental defects

  • Specificity assessment:

    • Perform domain-swapping experiments to identify regions responsible for substrate specificity

    • Use comparative interactomics to distinguish between shared and unique interacting partners

    • Conduct phylogenetic analysis combined with expression data to identify co-expressed ATL genes

  • Methodological approach:

    • Design ATL18-specific antibodies with validated specificity

    • Use CRISPR/Cas9 to introduce specific mutations or tags at the endogenous locus

    • Employ quantitative phenotyping approaches to detect subtle phenotypic differences

How can researchers overcome solubility issues with recombinant ATL18?

Solubility challenges are common when working with RING domain proteins. Consider these strategies:

  • Expression optimization:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration

    • Shorten induction time

  • Construct modifications:

    • Use solubility-enhancing tags (MBP, GST, SUMO)

    • Test both N- and C-terminal tag positions

    • Express only the functional RING domain for some applications

  • Buffer optimization:

    • Include 6% trehalose as mentioned in the product information

    • Test different pH values around the optimal pH 8.0

    • Add low concentrations of non-ionic detergents

    • Include zinc in buffers to stabilize the RING domain

  • Consider alternative expression systems if E. coli proves challenging

What controls are essential when analyzing contradictory data regarding ATL18 function?

When faced with contradictory data:

  • Essential controls to include:

    • RING domain mutants that abolish E3 ligase activity

    • Multiple independent transgenic/mutant lines

    • Appropriate wild-type controls

    • Complementation experiments to confirm phenotype causality

  • Experimental validation across methods:

    • Verify results using both in vitro and in vivo approaches

    • Confirm protein-protein interactions using multiple independent techniques

    • Assess functionality under different environmental conditions

  • Data analysis considerations:

    • Perform statistical analysis with appropriate sample sizes

    • Control for expression level differences when using overexpression

    • Consider developmental timing and tissue-specific effects

How can researchers distinguish between direct and indirect effects in ATL18 studies?

Distinguishing direct from indirect effects is challenging but essential:

  • Temporal resolution approaches:

    • Use inducible expression systems to capture immediate vs. late responses

    • Perform time-course experiments to identify primary and secondary effects

    • Utilize protein synthesis inhibitors to identify direct transcriptional targets

  • Biochemical evidence of direct interaction:

    • Demonstrate direct physical interaction through structural studies or in vitro binding assays

    • Show direct ubiquitination of candidate substrates in reconstituted systems

    • Identify specific binding domains or motifs required for direct interaction

  • Integrative approaches:

    • Combine genomics, proteomics, and biochemical data to build evidence for direct effects

    • Use network analysis to distinguish direct targets from downstream effectors

    • Apply mathematical modeling to predict direct vs. indirect regulatory relationships

Table 1: Comparison of Methods for Studying ATL18 Function

MethodAdvantagesLimitationsBest Applications
In vitro ubiquitinationDemonstrates direct enzymatic activity; Controlled conditionsMay not reflect in vivo complexity; Requires purified componentsBiochemical characterization; Substrate validation
Yeast two-hybridHigh-throughput screening; Detects binary interactionsHigh false positive/negative rates; Non-native conditionsInitial substrate identification; Interaction mapping
Co-immunoprecipitationCaptures native complexes; Can be coupled with MSMay include indirect interactions; Challenging for transient interactionsValidation of interactions; Protein complex identification
Genetic analysisReveals physiological relevance; Identifies phenotypesFunctional redundancy; Pleiotropic effectsIn vivo functional studies; Pathway analysis
Single-cell analysisCell type-specific insights; High resolutionTechnically challenging; Computational complexityCell type-specific expression; Developmental studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.