Recombinant Arabidopsis thaliana RING-H2 finger protein ATL20 (ATL20)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL20 (ATL20) is a protein that belongs to the ATL family of RING-H2 ubiquitin ligases . These proteins contain a RING-H2 domain and a transmembrane domain . RING finger proteins, including those of the RING-H2 type, are known to play a role in plant adaptation to abiotic stresses .

  • UniProt Accession Number: Q9C7E9

  • Species: Arabidopsis thaliana (Mouse-ear cress)

  • Gene Name: ATL20

  • Ordered Locus Names: At1g28040

  • ORF Names: F13K9.14

Structure and Function

The ATL family proteins, including ATL20, are characterized by the presence of a RING-H2 domain, a hydrophobic amino acid-rich region, and a GLD region . The RING-H2 domain is a variation of the canonical RING finger and contains a specific arrangement of eight zinc ligands, along with other conserved amino acid residues .

  • RING Finger Domain: The RING finger domain is a particular class of zinc finger domains consisting of 8 precisely spaced cysteine and histidine residues that coordinate 2 zinc ions in a cross-brace arrangement .

  • E3 Ligase Activity: RING finger proteins are a component of the ubiquitination pathway . As E3 ubiquitin ligases, they facilitate the transfer of ubiquitin to target proteins, influencing various cellular processes .

  • Interaction with E2 Enzymes: The RING finger domain directly binds to E2 enzymes, which are also involved in the ubiquitination process .

Expression and Localization

The ShATL78L gene, an ATL78-like gene in tomato, is constitutively expressed in various tissues such as root, leaf, petiole, stem, flower, and fruit . Its expression is also regulated under different stresses such as drought, salt, heat, wound, osmotic stress, and exogenous hormones .

  • Expression Region: The expression region for the recombinant protein is the full-length protein .

Role in Stress Response

ShATL78L, a cold-induced RING-H2 finger gene in wild tomato, is identified as an abiotic stress-responsive gene . Overexpression of ShATL78L in cultivated tomato improved tolerance to cold, drought, and oxidative stresses .

  • Abiotic Stress Tolerance: Overexpression of ShATL78L enhances cold, drought, and oxidative stress tolerance in tomato .

  • Hormonal Regulation: The expression of ShATL78L is induced by plant hormone treatments such as ETH, IAA, and SA, suggesting its role as a regulator in mediating different signaling pathways in response to abiotic stresses .

Interactions

  • RAV2 and CSN5B: RAV2 can bind to the promoter of ShATL78L and activates/alters its transcription, and CSN5B can interact with ShATL78L to regulate abiotic stress responses .

Research Findings

  • Antifungal Properties: Arabidopsis thaliana TCP21 (AtTCP21), a member of the TEOSINTE BRANCHED1/CYCLOIDEA/PROLIFERATING CELL FACTOR1 (TCP) family of transcription factors, has been identified as a novel antifungal protein (AFP) . Bacterially purified recombinant AtTCP21 inhibited the growth of various pathogenic fungal cells .

  • Transcriptional Regulation: The transcriptional landscape of Arabidopsis thaliana pattern-triggered immunity has been investigated .

  • Gene Family Expansion: The ATL family has been instrumental in evolution studies for showing how gene families are expanded in plant genomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL20; At1g28040; F13K9.14; RING-H2 finger protein ATL20; RING-type E3 ubiquitin transferase ATL20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL20
Target Protein Sequence
MSGTFLVDEINYQKQQISISDPENCMVKRLLTFNTSGSPFSYGFSFYYTFLTCPNEVVIP VWSLMSIPCLSNSTSSFFATSNLTFSKLLPPSCQIVKGLYVPVDVIYKDVITEEKGFSTV PWLGNVLLEWSSPNCRGCEKESLRCGFKNKASLEVKYLADPPDETKSRLRPLIITLCIIG GITATCIAAIRIYNSERFVNQRRQNAAITARNTTQQPRGVVVTTGLDQSTIESYKKVELG ESRRLPGTNGIICPICLSEYASKETVRCMPECDHCFHVQCIDEWLKIHSSCPVCRNSRS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G28040

STRING: 3702.AT1G28040.1

UniGene: At.51800

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.