Recombinant Arabidopsis thaliana RING-H2 finger protein ATL22 (ATL22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL22; At2g25410; F13B15.7; RING-H2 finger protein ATL22; RING-type E3 ubiquitin transferase ATL22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-377
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL22
Target Protein Sequence
SEQKPCYSFSCSQESVVARFPFSLFSYQPESCGYSGFNLICKDDANTTLKLPKSEPFLVK EIDYETQRIRLNDPENCLARRLLNFDPSGSPFSFLRSRNYTFLICPKEANITASFRAIDC LGNTTSSFFVVQFENLGSMPSSCHIFKILPLPFSWFVAYTTYPDGQNSRDMWLKWDSPDC RDCERRTNSRCGFKNNTSHQVECFSSVNPGLHNTGLQVLKIMCLSLVGPLTALTFCVGLV MCSSERVSSQIQQAVVARLSGSVTSQPSNEVARIGLDESTIESYKKVELGESRRLPTGSN DVVCPICLSEYATKETVRCLPECEHCFHTECIDAWLKLHSSCPVCRSNPSPLRD
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G25410

STRING: 3702.AT2G25410.1

UniGene: At.39022

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of the ATL22 protein?

ATL22 (At2g25410) is a 377-amino acid protein containing the characteristic RING-H2 finger domain typical of the ATL family. The mature protein sequence (amino acids 24-377) includes the conserved C3H2C3 zinc finger configuration where two histidine residues replace cysteines in the classical RING motif . The protein contains a highly conserved RING-H2 domain that facilitates binding to E2 ubiquitin-conjugating enzymes. The full-length recombinant protein includes an N-terminal domain that is rich in aliphatic residues followed by the C-terminal RING-H2 domain, a structural arrangement common to several small ATL proteins .

What is the function of the RING-H2 finger domain in ATL22?

The RING-H2 finger domain in ATL22 is essential for its E3 ubiquitin ligase activity. This domain specifically binds to E2 ubiquitin-conjugating enzymes, particularly those from the Ubc4/Ubc5 subfamily, to facilitate the transfer of ubiquitin to target substrate proteins . The zinc-coordinating residues in the RING-H2 domain form a cross-brace structure that creates a platform for E2 enzyme interaction. This interaction is crucial for the protein's ability to participate in ubiquitin-mediated protein degradation pathways .

How does ATL22 fit into the broader ATL family?

ATL22 is one of 80 ATL family members identified in Arabidopsis thaliana, part of a larger family of RING-type E3 ubiquitin transferases . The ATL gene family is characterized by a highly conserved RING-H2 finger motif found in otherwise unrelated proteins. Like approximately 90% of ATL genes, ATL22 is intronless, suggesting that its structure evolved as a functional module . The ATL family in Arabidopsis appears to be part of a larger class of approximately 470 RING zinc-finger domain proteins that function as ubiquitin ligases .

What expression systems are optimal for producing recombinant ATL22?

Recombinant ATL22 has been successfully expressed in E. coli systems with a His-tag fusion . For optimal expression, the mature protein sequence (amino acids 24-377) should be used rather than the full-length sequence including the signal peptide. Expression vectors containing strong promoters like T7 are recommended. Growth conditions should be optimized to reduce inclusion body formation, typically using lower induction temperatures (16-20°C) and reduced IPTG concentrations. Codon optimization may also improve expression efficiency in E. coli, as plant proteins often contain codons that are rare in bacterial systems .

What are the recommended storage and handling conditions for purified ATL22?

Purified recombinant ATL22 should be stored in Tris/PBS-based buffer at pH 8.0 with 6% trehalose to maintain stability . The protein is typically provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity . Working aliquots can be stored at 4°C for up to one week, but prolonged storage at this temperature is not recommended.

How can I verify the ubiquitin ligase activity of recombinant ATL22?

The ubiquitin ligase activity of recombinant ATL22 can be verified through in vitro ubiquitination assays. These assays typically include purified recombinant ATL22, an E1 ubiquitin-activating enzyme, an E2 ubiquitin-conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily), ubiquitin, ATP, and potential substrate proteins . The reaction products can be analyzed by SDS-PAGE followed by western blotting with anti-ubiquitin antibodies to detect ubiquitinated proteins. Controls should include reactions lacking individual components to ensure specificity. Auto-ubiquitination of ATL22 itself can also serve as a positive control for activity in the absence of known substrates .

How can ATL22 be used to study plant stress responses?

ATL22, like other ATL family members, can serve as a model for investigating ubiquitin-mediated protein degradation in plant stress responses. Researchers can use recombinant ATL22 to identify target proteins that are degraded under specific stress conditions. This can be achieved through techniques such as yeast two-hybrid screening, co-immunoprecipitation followed by mass spectrometry, or protein arrays incubated with the recombinant protein . Additionally, creating transgenic plants with altered ATL22 expression (overexpression or knockdown) can reveal phenotypic changes under various stress conditions, helping to elucidate the protein's role in stress adaptation pathways.

What approaches are effective for identifying ATL22 substrates?

Identification of ATL22 substrates can be approached through several complementary methods. Yeast two-hybrid screens can identify potential interacting proteins, though these should be validated through additional methods. Affinity purification using immobilized ATL22 followed by mass spectrometry can identify proteins that directly bind to ATL22. Proteomics approaches comparing protein abundances in wild-type versus ATL22 knockout or overexpression lines can identify proteins whose stability is affected by ATL22 activity . Substrate trapping approaches using catalytically inactive ATL22 mutants can also be effective for capturing transient enzyme-substrate interactions. Additionally, in vitro ubiquitination assays with candidate substrates can confirm direct ubiquitination by ATL22 .

What model systems are appropriate for investigating ATL22 function?

The primary model system for studying ATL22 function is Arabidopsis thaliana, where genetic tools such as T-DNA insertion lines, CRISPR-Cas9 gene editing, and transgenic overexpression can be employed . Heterologous expression in yeast has also proven useful for studying ATL proteins, as demonstrated with ATL2, which exhibits toxicity in yeast that is suppressed by mutations in the E2 enzyme Ubc4 . This approach can help identify functional E2-E3 pairs. Cell-free systems using plant extracts supplemented with recombinant ATL22 can be used to study ubiquitination processes in a more controlled environment. For protein-protein interaction studies, transient expression in tobacco leaves or Arabidopsis protoplasts offers advantages for rapid analysis .

How can I prevent aggregation of recombinant ATL22 during purification?

Preventing aggregation of recombinant ATL22 requires careful attention to buffer conditions and handling procedures. Include 5-10% glycerol in purification buffers to improve solubility. Adding low concentrations (1-5 mM) of reducing agents like DTT or β-mercaptoethanol can prevent disulfide bond formation and aggregation, which is particularly important for RING finger proteins with multiple cysteine residues . Purification at lower temperatures (4°C) and including protease inhibitors can minimize protein degradation that might lead to aggregation. If issues persist, consider adding mild detergents (0.01-0.05% Triton X-100) or optimizing salt concentration (typically 100-300 mM NaCl) to maintain solubility. Finally, protein concentration steps should be performed gradually to prevent precipitation at the concentration interface .

What controls should be included in ATL22 ubiquitination assays?

Robust controls are essential for interpreting ATL22 ubiquitination assays correctly. Negative controls should include reactions lacking ATP, E1, E2, or ATL22 to confirm that ubiquitination is enzyme-dependent and energy-dependent. A catalytically inactive ATL22 mutant (typically with mutations in key zinc-coordinating residues of the RING-H2 domain) serves as an important negative control to confirm that ubiquitination activity is specifically due to ATL22 and not contaminating E3 ligases. Positive controls should include a well-characterized E3-substrate pair. Time-course experiments can help distinguish between processivity and activity of the ubiquitination reaction. Additionally, temperature and pH controls can provide insights into optimal conditions for ATL22 activity .

How can specificity be ensured when studying ATL22 interactions with E2 enzymes?

Ensuring specificity in ATL22-E2 interaction studies requires multiple validation approaches. In vitro binding assays using purified recombinant proteins can directly measure affinity between ATL22 and various E2 enzymes. Competition assays with other RING-H2 proteins can determine relative binding preferences. Functional ubiquitination assays with different E2 enzymes can identify productive E2-E3 pairs. Based on studies with other ATL family members, ATL22 likely preferentially interacts with members of the Ubc4/Ubc5 subfamily of E2 conjugating enzymes . Site-directed mutagenesis of residues in the RING-H2 domain can identify specific amino acids crucial for E2 interaction. Structural studies using NMR or X-ray crystallography provide the most definitive evidence of specific interaction surfaces between ATL22 and its cognate E2 enzymes .

How might ATL22 function integrate into hormone signaling networks?

ATL22 may participate in hormone signaling networks through targeted degradation of signaling components. While specific information on ATL22's role is limited, research on related proteins suggests potential involvement in hormone pathways. For instance, ATL43 affects ABA sensitivity, and ATL2 is auxin-inducible . To investigate ATL22's role in hormone signaling, researchers should conduct transcriptome analyses comparing wild-type and ATL22 mutant plants treated with various hormones. Protein stability assays of known hormone signaling components in the presence or absence of functional ATL22 can identify potential regulatory targets. Genetic interaction studies crossing ATL22 mutants with hormone signaling mutants can reveal functional relationships. Hormone response assays (root growth, hypocotyl elongation, etc.) in ATL22 overexpression or knockout lines can provide phenotypic evidence of its involvement in specific hormone pathways .

What structural features determine ATL22's substrate specificity?

The substrate specificity of ATL22 likely depends on multiple structural features beyond the catalytic RING-H2 domain. While the RING-H2 domain interacts with E2 enzymes, other regions of the protein are probably responsible for substrate recognition. These may include the N-terminal domain rich in aliphatic residues or specific substrate-binding domains . Domain swapping experiments between different ATL family members can identify regions responsible for substrate specificity. Structural analysis through homology modeling, coupled with site-directed mutagenesis of potential substrate-binding surfaces, can further pinpoint specificity determinants. Hydrogen-deuterium exchange mass spectrometry can identify regions of ATL22 that undergo conformational changes upon substrate binding. Understanding these structural features is crucial for predicting natural substrates and potentially designing ATL22 variants with altered specificity for biotechnological applications .

How does post-translational modification affect ATL22 activity?

Post-translational modifications (PTMs) potentially regulate ATL22 activity, localization, or stability, though specific modifications of ATL22 have not been extensively characterized. Phosphorylation of E3 ligases often affects their activity or substrate recognition, and ATL22 contains multiple predicted phosphorylation sites that could be targeted by various kinases in response to cellular signals. Mass spectrometry-based proteomics approaches comparing PTMs on ATL22 under different conditions (developmental stages, stress treatments) can identify relevant modifications. Site-directed mutagenesis of modified residues to either prevent modification (e.g., Ser to Ala) or mimic constitutive modification (e.g., Ser to Asp for phosphorylation) can provide insights into functional consequences. Additionally, ATL22 itself might undergo auto-ubiquitination as a self-regulatory mechanism, which could be investigated through in vitro ubiquitination assays with purified components .

How does ATL22 compare functionally with other plant RING-H2 proteins?

ATL22 shares structural similarities with other ATL family members but may have distinct functional roles. Within Arabidopsis, there are 80 ATL family proteins, all containing the characteristic RING-H2 finger domain . Functional comparison requires systematic analysis of expression patterns, subcellular localization, and phenotypic effects of mutations. RNA-seq data across different tissues and conditions can reveal differential expression patterns. Yeast complementation assays using various ATL proteins can identify functional equivalence or specificity. Phylogenetic analysis combined with structural modeling can identify conserved and divergent features that might correlate with functional specialization. Creating chimeric proteins by domain swapping between ATL22 and other family members can identify which domains confer unique functional properties. Such comparative approaches can reveal whether ATL22 has evolved specialized functions or shares redundancy with other family members .

What is known about ATL22 orthologs in other plant species?

ATL family proteins are present across plant species, with 121 members identified in rice (Oryza sativa) . Approximately 60% of rice ATLs cluster with Arabidopsis ATLs, with sequence similarities extending beyond the conserved RING-H2 domain, suggesting potential orthologous relationships . To identify and characterize ATL22 orthologs, researchers should perform phylogenetic analyses using RING-H2 domain sequences and full-length protein sequences from multiple plant genomes. Synteny analysis can provide additional evidence for orthology. Expression pattern comparison between species can indicate conservation of regulatory mechanisms. Functional complementation studies, where the ATL22 ortholog from another species is expressed in Arabidopsis atl22 mutants, can demonstrate functional conservation. Such evolutionary analyses can provide insights into the conservation and diversification of ATL22 function across plant lineages and might reveal species-specific adaptations .

Table 1: Comparison of ATL Family Size Across Plant Species
Species
---------------------------
Arabidopsis thaliana
Oryza sativa (rice)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.