Recombinant Arabidopsis thaliana RING-H2 finger protein ATL2 (ATL2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Biochemical Properties

ATL2 is heterologously expressed in E. coli for functional studies:

ParameterSpecificationSource
Expression SystemE. coli (MBP-tagged or His-tagged fusion proteins).
Purity>90% as determined by SDS-PAGE.
Storage- Lyophilized powder in Tris/PBS buffer with trehalose (pH 8.0).
- Stable at -20°C/-80°C.
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage.

Role in Fungal Pathogen Defense

ATL2 is pivotal in combating fungal pathogens like Alternaria brassicicola:

PhenotypeObservationSource
ATL2 OverexpressionEnhanced resistance to A. brassicicola; reduced fungal hyphae growth.
ATL2 DeficiencyIncreased susceptibility; elevated AbCutA (cutinase) expression in hyphae.
MechanismTargets fungal cell wall components (e.g., chitin) via ubiquitination, triggering defense signaling.

Pathogen-Associated Molecular Pattern (PAMP) Response

ATL2 is rapidly induced by chitin, a fungal PAMP, with transcript accumulation peaking within 30 minutes of exposure . This induction is independent of de novo protein synthesis, as confirmed by cycloheximide treatment .

Yeast Toxicity and E2 Dependency

ATL2 exhibits conditional toxicity in Saccharomyces cerevisiae when overexpressed, requiring Ubc4 (yeast E2) for activity . Mutations in the RING-H2 domain disrupt E2 binding and toxicity, confirming its role in ubiquitination .

Functional Interactions

ATL2 interacts with components of the ubiquitin/26S proteasome system, regulating protein turnover during stress . Its plasma membrane localization positions it to detect extracellular pathogens and trigger downstream defense pathways .

Comparative Analysis with Related Proteins

ProteinDomain FeaturesFunctionSource
ATL2RING-H2, transmembrane helicesFungal defense, E3 ligase activity
ATL3RING-H2, transmembrane helicesUbiquitination (exact function uncharacterized)
OsRHC1 (Rice)RING-H2, transmembrane helicesBroad-spectrum disease resistance

Applications and Future Directions

ATL2’s recombinant form is valuable for:

  1. In Vitro Assays: Testing E3 ligase activity and substrate specificity .

  2. Plant Breeding: Engineering ATL2 overexpression to enhance crop resilience to fungal pathogens .

  3. Therapeutic Targets: Studying ATL2’s role in protein degradation pathways for agricultural and biotechnological innovations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATL2; At3g16720; MGL6.19; RING-H2 finger protein ATL2; Protein ARABIDOPSIS TOXICOS EN LEVADURA 2; Protein ATL2; RING-type E3 ubiquitin transferase ATL2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL2
Target Protein Sequence
MNSNDQDPIPFRPEDNNFSGSKTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRAR RRHLRRRSRNRRATMVFFTADPSTAATSVVASRGLDPNVIKSLPVFTFSDETHKDPIECA VCLSEFEESETGRVLPNCQHTFHVDCIDMWFHSHSTCPLCRSLVESLAGIESTAAARERE VVIAVDSDPVLVIEPSSSSGLTDEPHGSGSSQMLREDSGRKPAAIEVPRRTFSEFEDELT RRDSPASQSFRSPMSRMLSFTRMLSRDRRSASSPIAGAPPLSPTLSCRIQMTESDIERGG EESR
Uniprot No.

Target Background

Function
Involved in the early stages of plant defense signaling pathways.
Gene References Into Functions
  1. ECA2-dependent responses contribute to non-host defense against biotrophic and necrotrophic pathogens, and generalist insects, by modulating and priming innate immunity and late defense responses. [Eca2] PMID: 29130376
  2. ATL2, and other ATL family members, are activated, linking the induction of a putative class of ubiquitin ligases to plant defense signaling pathways. [ATL2] PMID: 15238540
  3. ATL proteins are ubiquitin ligases belonging to a multigene family. PMID: 16557337
Database Links

KEGG: ath:AT3G16720

STRING: 3702.AT3G16720.1

UniGene: At.22750

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Preferentially expressed around the apical meristem region.

Q&A

What is ATL2 and what are its key structural features?

ATL2 is a RING-H2 finger protein in Arabidopsis thaliana that functions as an E3 ubiquitin ligase. Bioinformatic analysis using tools such as SMART and DAS Transmembrane Prediction server reveals that ATL2 contains two key structural domains: a transmembrane domain located in the N-terminus (amino acids 30-57) and a RING-H2-type zinc finger motif in the middle region (amino acids 117-160) . This structural arrangement is characteristic of the ATL family proteins, which typically contain both a RING domain and a transmembrane domain.

The RING-H2 domain is a variant of the classical RING zinc finger domain and is critical for the protein's E3 ubiquitin ligase activity. The cysteine 138 residue within this domain has been identified as particularly important for its function . To study these domains, site-directed mutagenesis approaches targeting specific residues within the RING-H2 domain can be employed to assess their contribution to the protein's enzymatic activity.

Where is ATL2 localized in plant cells?

ATL2 is predominantly localized to the plasma membrane in plant cells. This localization has been confirmed through multiple experimental approaches:

  • Cell fractionation studies: When ATL2-HA protein was expressed in Arabidopsis whole plants and cell extracts were fractionated, Western blot analysis using anti-HA monoclonal antibody revealed that the majority of ATL2-HA protein was present in the membrane fraction, while it was undetectable in the soluble fraction .

  • Confocal microscopy: When ATL2 was fused to green fluorescent protein (GFP) under the control of the CaMV35S promoter and expressed in Nicotiana benthamiana, the ATL2-GFP signal co-localized with the plasma membrane marker AtPIP2A-mCherry .

These complementary approaches provide strong evidence for the plasma membrane localization of ATL2, which is consistent with its role in early defense signaling. For researchers investigating ATL2 localization, it is advisable to use both biochemical fractionation and live-cell imaging techniques to obtain comprehensive evidence.

How is ATL2 gene expression regulated in plants?

  • Quantitative RT-PCR analysis: Used to measure changes in ATL2 transcript levels after chitin treatment.

  • Histochemical β-glucuronidase (GUS) reporter experiments: Plants carrying the ATL2 promoter fused to the GUS reporter gene showed that expression is rapidly induced after exposure to chitin or inactivated crude cellulase preparations .

The rapid induction of ATL2 following chitin exposure suggests that it plays a role in the early stages of defense response triggered in plants in response to pathogen attack, particularly fungal pathogens . This pattern of expression regulation positions ATL2 as an early response gene in plant immunity.

What role does ATL2 play in plant defense against fungal pathogens?

ATL2 plays a positive and essential role in the defense response against fungal pathogens, particularly Alternaria brassicicola. Experimental evidence supporting this includes:

  • Loss-of-function studies: The atl2 null mutant (SALK_050772.54.50.x) exhibited higher susceptibility to A. brassicicola infection compared to wild-type plants .

  • Gain-of-function studies: Plants overexpressing ATL2 under the control of the CaMV35S promoter displayed increased resistance to A. brassicicola .

  • Pathogen growth assessment: Hyphae of A. brassicicola were strongly stained with trypan blue in atl2 mutants, indicating extensive fungal growth, while the hyphae were weakly stained in ATL2-overexpressing plants, suggesting restricted fungal growth .

  • Virulence gene expression: The expression of A. brassicicola Cutinase A (AbCutA) was dramatically increased in atl2 mutants but significantly reduced in ATL2-overexpressing plants .

These findings collectively demonstrate that ATL2 is necessary for a successful defense against the A. brassicicola fungal pathogen in Arabidopsis. The protein appears to restrict fungal growth and suppress virulence gene expression in the pathogen.

How does ATL2 protein stability relate to its function in defense responses?

ATL2 protein stability is dynamically regulated during plant defense responses:

  • Chitin-induced stabilization: ATL2 protein stability is markedly increased following chitin treatment . This suggests that not only is ATL2 gene expression induced by chitin, but the protein itself is also stabilized, potentially prolonging its activity during defense responses.

  • Proteasome-dependent degradation: ATL2 degradation is prolonged when 26S proteasomal function is inhibited . This indicates that under normal conditions, ATL2 protein levels are regulated by the ubiquitin/26S proteasome system.

The dual regulation of ATL2 at both the transcriptional level (increased gene expression) and post-translational level (increased protein stability) during pathogen challenge suggests sophisticated control mechanisms that ensure appropriate ATL2 activity during defense responses.

What is the relationship between ATL2 and the broader ATL gene family?

ATL2 belongs to a novel multigene family in Arabidopsis that contains a variant of the RING zinc finger domain known as RING-H2:

  • Family composition: The ATL gene family is represented by fifteen sequences that contain, in addition to the RING domain, a transmembrane domain which is located in most of them towards the N-terminal end .

  • Evolutionary conservation: Analysis of genes selected and sequences from Arabidopsis stored in databases permitted the prediction of several RING-H2 proteins that contain highly homologous RING domains .

  • Functional similarity: Rapid induction of transcript accumulation of multiple ATL family members is observed after exposure to chitin or inactivated crude cellulase preparations . This suggests that several members of the ATL family may be involved in the early stages of the defense response triggered in plants in response to pathogen attack.

Understanding the relationship between ATL2 and other ATL family members can provide insights into functional redundancy, specialization, and evolution of defense mechanisms in plants.

What approaches can be used to study ATL2's E3 ubiquitin ligase activity?

To investigate ATL2's E3 ubiquitin ligase activity, researchers can employ several complementary approaches:

  • In vitro ubiquitination assays: Recombinant ATL2 protein can be purified and tested for its ability to facilitate the transfer of ubiquitin from an E2 enzyme to a substrate protein in the presence of E1 enzyme, ATP, and ubiquitin.

  • Site-directed mutagenesis: Critical residues in the RING-H2 domain, particularly cysteine 138, can be mutated to assess their contribution to E3 ligase activity . The functional consequences of these mutations can be evaluated both in vitro and in vivo.

  • Substrate identification: Techniques such as yeast two-hybrid screening, co-immunoprecipitation followed by mass spectrometry, or protein arrays can be used to identify potential substrates of ATL2's E3 ligase activity.

  • In vivo ubiquitination assays: By co-expressing ATL2 with potential substrates in plant cells, researchers can assess whether the substrates show increased ubiquitination in the presence of ATL2.

ApproachAdvantagesLimitationsKey Controls
In vitro ubiquitinationDirect evidence of activityMay not reflect in vivo conditionsNo E3 control, catalytically inactive ATL2 mutant
Site-directed mutagenesisIdentifies critical residuesLimited to known domainsWild-type ATL2, unrelated mutations
Substrate identificationDiscovers biological targetsMay identify false positivesConfirmation with multiple methods
In vivo ubiquitinationPhysiologically relevantComplex system with many variablesEmpty vector, catalytically inactive ATL2

How can researchers effectively design experiments to study ATL2 function in plant defense?

To rigorously investigate ATL2's role in plant defense, researchers should consider a comprehensive experimental design that includes:

  • Genetic approaches:

    • Loss-of-function studies using atl2 null mutants (e.g., SALK_050772.54.50.x)

    • Gain-of-function studies using plants overexpressing ATL2 under constitutive promoters (e.g., CaMV35S)

    • Complementation studies to confirm phenotypes are due to ATL2 disruption

  • Pathogen challenge assays:

    • Infection with model pathogens like Alternaria brassicicola

    • Quantification of disease symptoms (e.g., lesion size, pathogen biomass)

    • Assessment of pathogen virulence gene expression (e.g., A. brassicicola Cutinase A)

  • Defense response markers:

    • Expression analysis of defense-related genes

    • Measurement of defense hormones (e.g., salicylic acid, jasmonic acid)

    • Histochemical staining to visualize defense responses (e.g., trypan blue for fungal growth)

  • Molecular mechanism investigations:

    • ATL2 protein stability assessment following pathogen challenge

    • Identification of ubiquitination targets during defense responses

    • Analysis of signaling pathway components affected by ATL2 activity

When designing these experiments, it's important to include appropriate controls (e.g., wild-type plants, mock treatments) and to use multiple independent biological replicates. Statistical analysis should be performed to determine the significance of observed differences.

How can contradictions in ATL2 functional data be resolved through experimental design?

When contradictory results emerge in ATL2 research, researchers can implement strategies based on structured contradiction analysis:

  • Parameter-based contradiction analysis: Using a notation system with parameters (α, β, θ) where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of required Boolean rules to assess these contradictions .

  • Multiple experimental approaches: Employing diverse methodologies to study the same question can help identify technique-specific artifacts or limitations that might lead to contradictory results.

  • Standardized experimental conditions: Ensuring that growth conditions, plant developmental stages, pathogen strains, and treatment protocols are consistent across experiments.

  • Genetic background considerations: Using multiple alleles of atl2 mutants and confirming that phenotypes can be complemented by reintroducing the ATL2 gene.

  • Cell-type and tissue-specific analyses: Investigating whether contradictory results might be explained by differences in ATL2 function across different cell types or tissues.

By systematically addressing potential sources of contradictions and implementing rigorous experimental designs, researchers can build a more consistent understanding of ATL2 function.

What techniques can be used to produce and purify recombinant ATL2 protein?

For in vitro studies of ATL2 function, researchers need to produce and purify recombinant ATL2 protein. The following approaches can be considered:

  • Expression systems:

    • Bacterial expression (E. coli): Suitable for producing soluble domains of ATL2 (e.g., the RING-H2 domain)

    • Yeast expression: May provide better folding for plant proteins

    • Insect cell expression: Often yields higher amounts of properly folded eukaryotic proteins

    • Plant-based expression: Offers the most native environment for ATL2 production

  • Solubility considerations:

    • As ATL2 contains a transmembrane domain, its full-length form may be difficult to express as a soluble protein

    • Expression of just the soluble domains (e.g., RING-H2 domain) may be preferable for certain studies

    • Addition of detergents or lipid nanodiscs can help solubilize the full-length protein

  • Purification strategies:

    • Affinity tags (His, GST, MBP) can facilitate purification

    • Size exclusion chromatography can separate properly folded protein from aggregates

    • Ion exchange chromatography can further purify based on charge properties

  • Activity verification:

    • In vitro ubiquitination assays to confirm that the purified protein retains E3 ligase activity

    • Structural studies (circular dichroism, thermal shift assays) to assess proper folding

When expressing recombinant ATL2, it's important to verify that the critical cysteine 138 residue is intact and that the purified protein retains its E3 ubiquitin ligase activity.

What methods are most effective for visualizing ATL2 expression and localization in plant tissues?

To visualize ATL2 expression patterns and subcellular localization in plant tissues, researchers can employ several complementary techniques:

  • Reporter gene fusions:

    • Promoter-GUS fusions: The ATL2 promoter fused to the β-glucuronidase (GUS) reporter gene allows visualization of ATL2 expression patterns through histochemical staining

    • Protein-fluorescent protein fusions: Full-length ATL2 fused to GFP or other fluorescent proteins enables live-cell imaging of ATL2 localization

  • Immunolocalization:

    • Immunofluorescence using antibodies against ATL2 or epitope tags (e.g., HA) can be used to detect endogenous or tagged ATL2 in fixed tissues

    • Immunogold labeling combined with electron microscopy provides higher resolution for precise subcellular localization

  • Cell fractionation and biochemical approaches:

    • Membrane fractionation followed by Western blotting can confirm the presence of ATL2 in specific cellular compartments

    • Aqueous two-phase partitioning can distinguish between different membrane types

  • Advanced imaging techniques:

    • Confocal microscopy for high-resolution imaging of fluorescently tagged ATL2

    • Fluorescence resonance energy transfer (FRET) to study protein-protein interactions involving ATL2

    • Fluorescence recovery after photobleaching (FRAP) to study the dynamics of ATL2 in membranes

Each of these approaches has strengths and limitations, and combining multiple techniques provides the most robust evidence for ATL2 expression patterns and localization.

What are the key phenotypic differences between wild-type, atl2 mutant, and ATL2-overexpressing plants?

The following table summarizes the key phenotypic differences observed in plants with different ATL2 expression levels when challenged with the fungal pathogen Alternaria brassicicola:

ParameterWild-type Plantsatl2 MutantATL2-Overexpressing Plants
Susceptibility to A. brassicicolaModerateHigherLower
Fungal hyphae (trypan blue staining)Moderate stainingStrongly stainedWeakly stained
A. brassicicola Cutinase A expressionModerateDramatically increasedSignificantly reduced
Disease symptomsModerateMore severeLess severe

These phenotypic differences demonstrate that ATL2 plays a positive role in defense against A. brassicicola, with its absence leading to increased susceptibility and its overexpression conferring enhanced resistance .

How does ATL2 expression change in response to different stimuli?

ATL2 expression is dynamically regulated in response to various stimuli, particularly those associated with pathogen recognition:

StimulusEffect on ATL2 ExpressionTimeframeDetection Method
ChitinRapid and significant inductionQuick responseqRT-PCR, GUS reporter
Inactivated crude cellulaseRapid inductionQuick responseGUS reporter
Normal growth conditionsLow, ubiquitous expressionConstitutiveqRT-PCR, GUS reporter

The rapid induction of ATL2 in response to chitin, a component of fungal cell walls, and inactivated crude cellulase preparations suggests that ATL2 is involved in the early stages of the defense response triggered in plants in response to pathogen attack .

What is the conservation of key functional domains across the ATL family?

The ATL gene family in Arabidopsis is characterized by the presence of specific structural features:

FeatureLocationFunctionConservation across ATL Family
RING-H2 domainMiddle region (117-160 a.a. in ATL2)E3 ubiquitin ligase activityHighly conserved
Transmembrane domainN-terminus (30-57 a.a. in ATL2)Membrane localizationPresent in most family members
Cysteine 138Within RING-H2 domainCritical for E3 ligase functionConserved in functional family members

Analysis of the fifteen sequences in the ATL gene family reveals that they all contain highly homologous RING domains in addition to a transmembrane domain, which is located in most of them towards the N-terminal end . This conservation suggests functional similarities among ATL family members, particularly in their roles as membrane-localized E3 ubiquitin ligases.

What are the key questions that remain unanswered about ATL2 function?

Despite significant progress in understanding ATL2, several important questions remain for future research:

  • Substrate identification: What are the specific proteins targeted for ubiquitination by ATL2? Identifying these substrates is crucial for understanding the molecular mechanisms by which ATL2 contributes to plant defense.

  • Regulation of ATL2 activity: Beyond transcriptional induction and protein stability, how is ATL2's E3 ligase activity regulated? Are there post-translational modifications or protein-protein interactions that modulate its function?

  • Signaling pathway integration: How does ATL2 integrate into broader immune signaling networks? What are the upstream regulators and downstream effectors of ATL2-mediated signaling?

  • Evolutionary conservation: Is the function of ATL2 conserved across plant species, and how has it evolved to respond to different pathogens?

  • Potential for agricultural applications: Can knowledge of ATL2 function be leveraged to develop strategies for enhancing crop resistance to fungal pathogens?

Addressing these questions will require a combination of genetic, biochemical, and computational approaches, as well as collaboration between researchers with expertise in different aspects of plant biology and pathology.

How can advanced experimental design approaches be applied to study ATL2 in complex plant-pathogen interactions?

To investigate ATL2 function in complex plant-pathogen interactions, researchers should consider advanced experimental design approaches:

  • Systems biology approaches: Integrating transcriptomics, proteomics, and metabolomics data to build comprehensive models of ATL2's role in defense networks.

  • Time-course experiments: Capturing the dynamic changes in ATL2 expression, localization, and activity at different stages of pathogen infection.

  • Cell-type specific analyses: Using techniques like fluorescence-activated cell sorting (FACS) or laser capture microdissection to study ATL2 function in specific cell types involved in pathogen response.

  • Multi-omics data integration: Combining data from different levels (genome, transcriptome, proteome, metabolome) to build a comprehensive understanding of ATL2 function.

  • Contradiction analysis frameworks: Implementing structured approaches to resolve contradictions in complex data sets, such as the (α, β, θ) notation system for contradiction patterns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.