Recombinant Arabidopsis thaliana RING-H2 finger protein ATL33 (ATL33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
ATL33; At2g37580; F13M22.1; RING-H2 finger protein ATL33; RING-type E3 ubiquitin transferase ATL33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL33
Target Protein Sequence
MFNNTTTSFGSGPGIVVVPTPATTVPTTDFPGTTITSNSTFIIIGPPPPFPAPPRSIDLT PLKLIFVVIAFVAVPALVYALFFNGPCSSSRRNSSSSRTSSSSDDTPHATVDTPPITETT VTSESGGKFHKDTHSKEIGNECSVCLMVFTDSDELRQLSECKHAFHVLCIETWLKDHPNC PICRTDVSVKQQTEAPNVPVNVNGNVNRSGGNRRVSATSRDDDWRQGLPDASSLV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G37580

STRING: 3702.AT2G37580.1

UniGene: At.37407

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL33 and what is its role in Arabidopsis thaliana?

ATL33 is a member of the ATL (Arabidopsis Tóxicos en Levadura) gene family that encodes RING-H2 finger domain proteins in Arabidopsis thaliana. It functions as a ubiquitin ligase in the ubiquitin/26S proteasome pathway, playing a regulatory role in protein degradation processes. The ATL gene family comprises approximately 80 members in Arabidopsis thaliana and 121 in Oryza sativa (rice) . ATL33, specifically, is one of the RING zinc-finger domain proteins that participate in substrate specification and mediate the transfer of ubiquitin to target proteins, contributing to the sophisticated protein degradation system in plants .

How is ATL33 structurally characterized?

ATL33 is characterized by a RING-H2 finger domain, which is crucial for its ubiquitin ligase activity. The recombinant full-length Arabidopsis thaliana RING-H2 finger protein ATL33 consists of 235 amino acids (full length 1-235) . Like approximately 90% of ATL genes in Arabidopsis, ATL33 is likely an intronless gene, suggesting that its structure evolved as a functional module . The protein can be produced with a His-tag for research purposes, typically expressed in an E. coli system to maintain its functional properties .

What is the relationship between ATL33 and other members of the ATL family?

ATL33 is one of 80 members of the ATL family identified in Arabidopsis thaliana. The ATL family is part of a larger class of approximately 470 RING zinc-finger domain proteins in Arabidopsis that function as ubiquitin ligases . Comparative genomic analysis has shown that about 60% of rice ATLs are clustered with Arabidopsis ATLs, with significant sequence similarities beyond the conserved features, suggesting potential orthologous relationships . This conservation across species highlights the evolutionary importance of the ATL family, including ATL33, in plant biological processes.

What are the best methodological approaches for studying ATL33 function?

For studying ATL33 function, a comprehensive approach incorporating both in vivo and in vitro methods is recommended. Begin with T-DNA insertion mutant analysis to establish phenotypic effects, similar to the approach used for other ATL genes where researchers identified ABA-insensitive phenotypes in ATL43 mutants . For protein interaction studies, use yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays to identify proteins that interact with ATL33 .

For functional characterization, implement the DescRep experimental design approach, which combines iteratively refined descriptor selection with sampling based on representative compounds. This approach has been shown to perform significantly better than traditional methods that select all compounds simultaneously, providing more reliable results for protein function studies . Finally, conduct expression profiling across different tissues and under various stress conditions to determine the spatiotemporal regulation of ATL33.

How should researchers design experiments to study ATL33's ubiquitin ligase activity?

When designing experiments to study ATL33's ubiquitin ligase activity, researchers should implement a stepwise adaptive approach to experimental design. First, establish an in vitro ubiquitination assay using purified recombinant ATL33 protein with His-tag . This system should include E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), ubiquitin (preferably tagged for detection), ATP, and potential substrate proteins.

For experimental design optimization, use the DescRep approach, which combines an iteratively refined descriptor selection with sampling based on representative compounds . This methodology allows for:

  • Initial screening of potential substrates and E2 enzymes that work with ATL33

  • Refinement of conditions based on preliminary data

  • Comprehensive testing of optimized parameters

Monitor ubiquitination through Western blot analysis using antibodies against ubiquitin or the substrate protein. Complement these biochemical assays with in vivo approaches, including co-expression of ATL33 with potential substrates in plant protoplasts and monitoring substrate stability in the presence or absence of proteasome inhibitors.

What controls should be included when investigating ATL33 expression patterns?

When investigating ATL33 expression patterns, several critical controls should be implemented to ensure data reliability:

  • Negative Controls:

    • Include knockout or knockdown ATL33 mutants to validate antibody or primer specificity

    • Use samples from tissues where ATL33 is predicted to have minimal expression

    • Include no-template controls in PCR/qPCR experiments

  • Positive Controls:

    • Test tissues where other ATL family members are known to be expressed

    • Include constitutively expressed reference genes (e.g., ACTIN, UBIQUITIN, GAPDH) as internal controls

    • Use recombinant ATL33 protein as a standard for antibody tests

  • Experimental Validation Controls:

    • Compare expression across multiple biological and technical replicates

    • Validate qPCR results with alternative methods (e.g., RNA-seq, protein detection)

    • Test expression under various environmental conditions known to affect RING-H2 proteins

Additionally, researchers should consider the impact of developmental stages on expression, as evidenced by the finding that some ATL genes, such as ATL8, are mainly expressed in specific developmental contexts (young siliques) . For transcriptomic analysis, utilize high-resolution platforms like AtRTD3, which provides comprehensive Arabidopsis transcriptome data for improved precision in differential gene and transcript expression analysis .

How can contradictory findings in ATL33 research be effectively reconciled?

When encountering contradictory findings in ATL33 research, implement a systematic approach to reconciliation:

  • Re-examine methodological differences: Compare experimental designs, focusing on selection strategies like DescRep versus traditional approaches, as these can significantly impact results .

  • Verify data integrity: Assess whether contradictions stem from data quality issues by:

    • Re-analyzing raw data independently

    • Checking for batch effects or experimental artifacts

    • Evaluating statistical methods for appropriateness

  • Consider biological context: Assess whether contradictions reflect genuine biological variability by:

    • Examining differences in plant growth conditions

    • Considering developmental stages and tissue-specificity

    • Evaluating the impact of environmental stressors

  • Implement collaborative validation: Establish a cross-laboratory validation protocol where:

    • Identical biological materials are analyzed

    • Standardized protocols are employed

    • Results are compared through blinded analysis

  • Conduct meta-analysis: Integrate available data from multiple studies to identify:

    • Consistent patterns across diverse experimental conditions

    • Variables that correlate with divergent outcomes

    • Potential mediating factors explaining contradictions

This approach aligns with best practices in resolving data contradictions, emphasizing that differing results often reveal important biological nuances rather than experimental errors .

What are the most effective techniques for studying ATL33 protein interactions?

For studying ATL33 protein interactions, a multi-tiered approach yields the most comprehensive results:

  • In Silico Prediction Methods:

    • Use protein-protein interaction databases to identify candidates

    • Employ molecular modeling tools to predict binding sites

    • Analyze co-expression data across tissues and conditions

  • Yeast-Based Screening Approaches:

    • Implement yeast two-hybrid (Y2H) with ATL33 as bait

    • Use split-ubiquitin systems for membrane-associated interactions

    • Validate hits with targeted Y2H confirmations

  • In Vitro Biochemical Methods:

    • Perform pull-down assays using recombinant His-tagged ATL33

    • Conduct co-immunoprecipitation with epitope-tagged proteins

    • Utilize surface plasmon resonance for binding kinetics

  • In Vivo Plant-Based Approaches:

    • Implement bimolecular fluorescence complementation (BiFC)

    • Use co-immunoprecipitation from plant tissues

    • Apply proximity-dependent labeling techniques

  • Advanced Proteomic Strategies:

    • Deploy tandem affinity purification (TAP) tagging

    • Implement cross-linking mass spectrometry (XL-MS)

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS)

For each approach, apply adaptive experimental design principles to refine protocols and maximize discovery potential . This comprehensive workflow will help identify both stable and transient interactions, providing insights into ATL33's functional role in the ubiquitin/26S proteasome pathway .

How can researchers effectively analyze ATL33 mutant phenotypes in the context of redundancy within the ATL family?

When analyzing ATL33 mutant phenotypes in the context of ATL gene family redundancy, researchers should implement the following strategic approach:

  • Generate multiple mutant combinations:

    • Create single, double, and higher-order mutants of phylogenetically related ATL genes

    • Use CRISPR-Cas9 for simultaneous targeting of multiple ATL family members

    • Develop inducible RNAi systems to allow temporal control of gene silencing

  • Implement comprehensive phenotypic analysis:

    • Screen mutants under diverse environmental conditions to reveal conditional phenotypes

    • Conduct developmental time-course studies to identify stage-specific roles

    • Apply high-throughput phenotyping platforms to detect subtle phenotypic alterations

  • Utilize transcriptome profiling:

    • Compare expression patterns of all ATL family members in mutant backgrounds

    • Identify compensatory upregulation of related genes in ATL33 mutants

    • Use AtRTD3 or similar high-resolution transcriptome resources for precise quantification

  • Apply biochemical profiling:

    • Compare substrate specificity across ATL family members

    • Assess differences in ubiquitination efficiency using in vitro assays

    • Characterize protein-protein interaction networks for functionally related ATLs

  • Conduct complementation studies:

    • Test whether related ATL proteins can rescue ATL33 mutant phenotypes

    • Use domain-swapping experiments to identify functional regions conferring specificity

    • Implement tissue-specific promoters to assess spatial aspects of functional redundancy

This systematic approach acknowledges the challenges posed by the large ATL family (80 members in Arabidopsis) , where functional redundancy may mask phenotypes in single mutants, similar to observations in other ATL genes where only specific phenotypes were detected despite broader expression patterns .

What are the potential applications of understanding ATL33 function in agriculture?

Understanding ATL33 function offers several promising agricultural applications:

  • Stress Response Engineering:

    • ATL family members have been implicated in plant responses to environmental stresses

    • Knowledge of ATL33's specific role could allow for targeted modification of stress response pathways

    • Engineering plants with optimized ATL33 activity could potentially enhance drought, salt, or pathogen resistance

  • Developmental Regulation:

    • The finding that some ATL family members are essential for viability suggests crucial developmental roles

    • Understanding ATL33's function could provide insights for optimizing plant growth and development

    • Manipulation of ATL33 expression patterns might allow for beneficial alterations in plant architecture

  • Hormone Response Modulation:

    • The identification of ABA-insensitive phenotypes in ATL43 mutants indicates roles in hormone signaling for ATL family members

    • Characterization of ATL33's role in hormone pathways could allow fine-tuning of crop responses to growth regulators

    • This knowledge could lead to improved germination, flowering, or senescence traits

  • Protein Homeostasis Optimization:

    • As a ubiquitin ligase in the ubiquitin/26S proteasome pathway, ATL33 influences protein turnover

    • Targeted modifications of ATL33 activity could potentially regulate levels of key metabolic enzymes

    • This approach might enable enhanced nutrient use efficiency or increased production of valuable metabolites

These applications would benefit from adaptive experimental design approaches to optimize ATL33 manipulations for specific agricultural contexts .

How can high-throughput techniques be applied to study ATL33 function?

High-throughput techniques offer powerful approaches for comprehensive ATL33 functional characterization:

  • Transcriptomics Applications:

    • Implement RNA-Seq using the AtRTD3 reference transcriptome for accurate transcript quantification

    • Apply single-cell RNA-Seq to identify cell-specific expression patterns

    • Use time-course transcriptomics to capture dynamic responses following ATL33 perturbation

  • Proteomics Approaches:

    • Deploy tandem mass tag (TMT) proteomics to compare protein abundance in wild-type versus ATL33 mutants

    • Implement ubiquitinome analysis to identify potential ATL33 substrates

    • Use protein arrays to screen for ATL33 interactors across the proteome

  • Phenomics Strategies:

    • Apply automated plant phenotyping platforms to capture subtle ATL33 mutant phenotypes

    • Implement hyperspectral imaging to detect biochemical changes in ATL33-modified plants

    • Use growth rate monitoring systems to identify developmental impacts of ATL33 perturbation

  • Metabolomics Techniques:

    • Conduct untargeted metabolomics to identify metabolic pathways influenced by ATL33 activity

    • Apply flux analysis to determine how ATL33 affects metabolic dynamics

    • Integrate metabolomic and transcriptomic data to construct ATL33-influenced pathway models

  • Computational Integration:

    • Implement the DescRep approach to optimize experimental design for high-throughput studies

    • Use machine learning algorithms to identify patterns in multi-omics datasets

    • Develop network models to contextualize ATL33 function within broader cellular processes

When applying these techniques, researchers should address data contradictions systematically through the approaches outlined previously , ensuring robust interpretation of high-throughput results.

What are the current gaps in ATL33 research and future research priorities?

Current research gaps and future priorities for ATL33 investigation include:

  • Substrate Identification:

    • Despite understanding that ATL33 functions as a ubiquitin ligase, specific substrates remain largely unknown

    • Priority: Implement proteome-wide approaches to identify ubiquitination targets

    • Develop methods to distinguish direct ATL33 substrates from those targeted by related ATL proteins

  • Regulatory Mechanisms:

    • How ATL33 itself is regulated remains poorly understood

    • Priority: Investigate transcriptional, post-transcriptional, and post-translational regulation of ATL33

    • Characterize factors that modulate ATL33 activity under different environmental conditions

  • Functional Redundancy:

    • The extent of functional overlap between ATL33 and other ATL family members needs clarification

    • Priority: Generate and characterize higher-order mutants of phylogenetically related ATL genes

    • Conduct comparative analyses of substrate specificity among ATL family proteins

  • Structural Characterization:

    • Detailed structural information about ATL33 is limited

    • Priority: Obtain crystal or NMR structures of ATL33, particularly in complex with substrates

    • Use structural data to guide rational engineering of ATL33 for altered specificity

  • Metabolic Integration:

    • ATL33's role in broader metabolic networks remains to be established

    • Priority: Integrate transcriptomic, proteomic, and metabolomic data to position ATL33 in cellular pathways

    • Develop models predicting the effects of ATL33 perturbation on plant metabolism

  • Translational Applications:

    • The potential for agricultural applications has not been fully explored

    • Priority: Test whether ATL33 modifications can enhance stress tolerance or other agronomic traits

    • Evaluate the conservation of ATL33 function across crop species for broader application

Addressing these gaps will require implementation of advanced experimental design approaches like DescRep and careful reconciliation of potentially contradictory findings as the research field develops.

What statistical approaches are most appropriate for analyzing ATL33 expression data?

When analyzing ATL33 expression data, researchers should implement a tiered statistical approach:

  • Data Quality Assessment:

    • Perform normality testing (Shapiro-Wilk or Kolmogorov-Smirnov)

    • Evaluate homogeneity of variance (Levene's test)

    • Identify and address outliers using robust statistical methods

    • Apply appropriate normalization techniques for the specific expression platform

  • Differential Expression Analysis:

    • For comparing two conditions: Student's t-test (parametric) or Mann-Whitney U test (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey HSD, Bonferroni)

    • For complex experimental designs: linear mixed models to account for random effects

    • Implement multiple testing correction (Benjamini-Hochberg FDR) to control false discoveries

  • Time-Course and Developmental Analysis:

    • Apply repeated measures ANOVA for consistent sampling designs

    • Use polynomial regression to model expression trends over time

    • Implement time-series analysis methods (e.g., autoregressive models) for complex patterns

    • Consider growth curve modeling for developmental expression profiling

  • Co-expression Network Analysis:

    • Calculate correlation coefficients (Pearson or Spearman) to identify co-expressed genes

    • Apply clustering algorithms (hierarchical, k-means) to identify expression modules

    • Implement network analysis methods to position ATL33 within regulatory networks

    • Use gene set enrichment analysis to interpret co-expression modules

  • Comparative Expression Analysis:

    • Apply rank product statistics for cross-platform comparisons

    • Use meta-analysis techniques to integrate findings across studies

    • Implement Bayesian methods to incorporate prior knowledge into analyses

When faced with contradictory results, follow the systematic approach to reconciliation outlined earlier . For optimization of experimental design, apply adaptive methodologies like DescRep to maximize information gain while minimizing resource expenditure .

How can researchers effectively visualize and interpret ATL33 protein interaction networks?

For effective visualization and interpretation of ATL33 protein interaction networks, researchers should follow these comprehensive guidelines:

  • Network Visualization Strategies:

    • Implement force-directed layouts (e.g., Fruchterman-Reingold algorithm) for balanced network visualization

    • Use edge-weighted spring embedders to represent interaction strengths visually

    • Apply hierarchical layouts when emphasizing regulatory relationships

    • Employ circular layouts to highlight modular organization within the network

    • Implement dynamic visualization tools that allow filtering and parameter adjustment

  • Network Annotation and Enrichment:

    • Color-code nodes based on biological function, subcellular localization, or expression patterns

    • Size nodes according to metrics like degree centrality or betweenness centrality

    • Apply edge styling to distinguish interaction types (physical, genetic, predicted)

    • Overlay expression data to create context-specific networks

    • Perform functional enrichment analysis on network modules

  • Topological Analysis:

    • Calculate centrality measures to identify key players (degree, betweenness, closeness centrality)

    • Identify network motifs that may represent functional units

    • Apply community detection algorithms to uncover functional modules

    • Calculate clustering coefficients to assess network organization

    • Analyze network resilience by simulating node removal

  • Comparative Network Analysis:

    • Compare ATL33 networks with those of related ATL family members

    • Identify conserved and divergent interaction patterns

    • Analyze network evolution across different plant species

    • Implement differential network analysis to identify condition-specific interactions

  • Integration with Other Data Types:

    • Overlay transcriptomic data to create condition-specific networks

    • Incorporate protein structural information to explain interaction mechanisms

    • Integrate phenotypic data to connect network perturbations with physiological outcomes

    • Apply machine learning approaches to predict functional consequences of network alterations

When developing these networks, researchers should be mindful of potential contradictions in interaction data and apply systematic approaches to reconciliation . Networks should be validated using multiple experimental approaches as outlined in the protein interaction methodologies section.

What bioinformatic tools and databases are most valuable for ATL33 research?

For comprehensive ATL33 research, the following bioinformatic tools and databases provide essential resources:

  • Sequence Analysis and Annotation:

    • TAIR (The Arabidopsis Information Resource): Primary repository for Arabidopsis genome information

    • UniProt: Detailed protein annotation including domains and post-translational modifications

    • Pfam: Database of protein families for identifying conserved domains in ATL33

    • InterPro: Integrated database of protein families and domains

    • SMART: Tool for identifying protein domains and analyzing domain architecture

  • Expression Analysis:

    • AtRTD3: High-resolution Arabidopsis transcriptome database for precise transcript quantification

    • BAR eFP Browser: Visualization tool for tissue-specific expression patterns

    • GEO (Gene Expression Omnibus): Repository of expression data from various experiments

    • Expression Atlas: Curated database of gene expression across tissues and conditions

    • Genevestigator: Platform for analyzing expression across multiple experiments

  • Protein Interaction Prediction and Analysis:

    • STRING: Database of known and predicted protein-protein interactions

    • BioGRID: Repository of protein and genetic interactions

    • IntAct: Open-source database system for molecular interaction data

    • Cytoscape: Platform for network visualization and analysis

    • MCODE: Cytoscape plugin for identifying densely connected network modules

  • Structural Analysis:

    • AlphaFold: AI system for protein structure prediction

    • SWISS-MODEL: Automated protein homology-modeling server

    • PDB (Protein Data Bank): Repository of 3D structural data of proteins

    • PyMOL: Visualization tool for molecular structures

    • RING-H2 specific databases: Specialized resources for RING finger proteins

  • Functional Prediction:

    • Gene Ontology (GO): Standardized vocabulary for gene function annotation

    • KEGG Pathway Database: Collection of pathway maps for understanding biological systems

    • Plant Reactome: Curated resource for plant metabolic and regulatory pathways

    • SUBA4: Subcellular localization database for Arabidopsis proteins

    • Araport: Integrated data portal for Arabidopsis research

  • Experimental Design Tools:

    • DescRep: Stepwise adaptive approach for experimental design optimization

    • R/Bioconductor packages: Statistical tools for experimental planning and analysis

    • NCBI Primer-BLAST: Tool for designing target-specific PCR primers

    • CRISPR-P: Tool for designing CRISPR-Cas9 guide RNAs for plant genomes

When using these resources, researchers should implement systematic approaches to reconcile potentially contradictory information and organize their experimental design to maximize information gain while minimizing resource expenditure .

What is the optimal protocol for expressing and purifying recombinant ATL33 protein?

For optimal expression and purification of recombinant ATL33 protein, the following detailed protocol is recommended:

  • Expression System Selection:

    • Recommended system: E. coli BL21(DE3) for His-tagged ATL33 expression

    • Alternative systems: Rosetta(DE3) for rare codon optimization or SHuffle for enhanced disulfide bond formation

    • Expression vector: pET-28a(+) containing full-length ATL33 (1-235 amino acids) with N-terminal His-tag

  • Expression Optimization:

    • Induction conditions: 0.5 mM IPTG at OD600 0.6-0.8

    • Temperature optimization: Test expression at 37°C (4 hours), 25°C (8 hours), and 18°C (overnight)

    • Media selection: Compare LB, TB, and auto-induction media for yield optimization

    • Additives: Include 0.1 mM ZnCl2 in media to ensure proper folding of the RING-H2 domain

  • Cell Lysis and Initial Clarification:

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, 5% glycerol

    • Lysis method: Sonication (6 cycles of 30s on/30s off) or high-pressure homogenization

    • Protease inhibitors: Include EDTA-free protease inhibitor cocktail

    • Clarification: Centrifugation at 18,000g for 30 minutes at 4°C

  • Affinity Purification:

    • Resin selection: Ni-NTA agarose for His-tagged ATL33

    • Binding conditions: 1 hour at 4°C with gentle rotation

    • Washing steps: Incremental imidazole washes (20 mM, 40 mM) to remove non-specific binding

    • Elution conditions: 250 mM imidazole in base buffer

  • Secondary Purification:

    • Size exclusion chromatography: Superdex 75 column in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT

    • Alternative: Ion exchange chromatography using Resource Q column

  • Quality Control Assessment:

    • Purity analysis: SDS-PAGE with Coomassie staining (target >95% purity)

    • Western blot validation: Anti-His antibody detection

    • Mass spectrometry confirmation: MALDI-TOF for molecular weight verification

    • Activity assay: In vitro ubiquitination assay to confirm functionality

  • Storage Optimization:

    • Concentration: Concentrate to 1-5 mg/ml using 10 kDa MWCO concentrators

    • Storage buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 10% glycerol

    • Storage conditions: Flash-freeze in liquid nitrogen and store at -80°C in small aliquots

This protocol should be optimized following adaptive experimental design principles , with initial small-scale expression tests to determine optimal conditions before scaling up. If contradictory results are obtained during optimization, implement the systematic reconciliation approach discussed earlier .

How can researchers effectively design and implement CRISPR-Cas9 strategies for ATL33 gene editing?

For effective CRISPR-Cas9 gene editing of ATL33 in Arabidopsis thaliana, researchers should implement this comprehensive protocol:

  • Guide RNA Design:

    • Target selection: Design sgRNAs targeting the ATL33 RING-H2 finger domain for functional disruption

    • Design tools: Use CRISPR-P or similar plant-specific tools to design guide RNAs

    • Specificity assessment: Perform whole-genome off-target analysis, selecting guides with minimal off-target potential

    • Efficiency prediction: Apply scoring algorithms to predict cutting efficiency

    • Structural considerations: Avoid regions with strong secondary structures that might impair Cas9 access

  • Vector Construction:

    • Vector selection: Use plant-optimized vectors (e.g., pFGC-pcoCas9 for Arabidopsis)

    • Promoter choice: U6 promoter for sgRNA expression; 35S or UBQ10 for Cas9 expression

    • Selection marker: Include appropriate plant selection markers (e.g., Basta, hygromycin)

    • Cloning strategy: Golden Gate assembly for multiplexing if targeting multiple sites

  • Plant Transformation:

    • Method selection: Floral dip transformation for Arabidopsis

    • Agrobacterium strain: GV3101 or similar for efficient transformation

    • Selection protocol: Apply appropriate antibiotic/herbicide selection based on vector design

    • T1 screening: PCR-based genotyping to identify transformants

  • Mutation Detection and Characterization:

    • Primary screening: T7 Endonuclease I assay or heteroduplex mobility assay

    • Sequencing confirmation: Sanger sequencing of PCR amplicons spanning target sites

    • High-throughput analysis: Next-generation sequencing for complex editing events

    • Protein level verification: Western blot analysis to confirm protein disruption

  • Off-target Analysis:

    • Computational prediction: Identify potential off-target sites in silico

    • Experimental validation: PCR and sequencing of predicted off-target sites

    • Whole-genome sequencing: For comprehensive off-target detection in key lines

  • Phenotypic Characterization:

    • Growth condition optimization: Test multiple environmental conditions to reveal conditional phenotypes

    • Developmental analysis: Assess growth, development, and reproduction

    • Stress response testing: Evaluate responses to abiotic and biotic stresses

    • Molecular phenotyping: Transcriptome, proteome, and metabolome analysis

  • Complementation Studies:

    • Construct design: Create complementation constructs with native or tissue-specific promoters

    • Transformation: Transform mutant lines with wild-type ATL33 or domain variants

    • Functional validation: Assess phenotypic rescue to confirm specificity of observed phenotypes

When designing these experiments, implement the DescRep approach to optimize design parameters and maximize information gain . If contradictory results emerge during phenotypic analysis, apply the systematic reconciliation framework to resolve discrepancies . Remember that ATL33 may have functional redundancy with other ATL family members, potentially masking phenotypes in single mutants .

What are the most reliable qPCR protocols for quantifying ATL33 expression?

For reliable quantification of ATL33 expression via qPCR, researchers should follow this detailed protocol:

  • Primer Design and Validation:

    • Specificity requirements: Design primers unique to ATL33, avoiding cross-reactivity with other ATL family members

    • Design parameters: Amplicon size 80-150 bp, Tm 58-62°C, GC content 40-60%

    • Primer location: Span exon-exon junctions where possible, although ATL33 is likely intronless like 90% of ATL genes

    • In silico validation: Use BLAST to confirm target specificity

    • Experimental validation: Confirm single amplicon via melt curve analysis and gel electrophoresis

    • Efficiency testing: Generate standard curves using serial dilutions to ensure 90-110% efficiency

  • RNA Extraction and Quality Control:

    • Extraction method: Use RNeasy Plant Mini Kit or TRIzol-based extraction with modifications for plant tissues

    • DNase treatment: Implement rigorous DNase treatment to eliminate genomic DNA contamination

    • Quality assessment: Verify RNA integrity using Bioanalyzer (RIN > 8) or gel electrophoresis

    • Quantification: Use spectrophotometry (A260/A280 ratio ~2.0) and fluorometric methods for accurate quantification

  • cDNA Synthesis:

    • Reverse transcriptase selection: SuperScript IV or similar high-fidelity enzyme

    • Priming strategy: Oligo(dT) combined with random hexamers for comprehensive coverage

    • Input standardization: Use equal amounts of RNA (500-1000 ng) across all samples

    • RT-minus controls: Include no-RT controls to detect genomic DNA contamination

  • qPCR Setup and Execution:

    • Reaction components: SYBR Green or probe-based detection systems

    • Reaction volume: 10-20 μl with optimized primer concentrations (typically 300-500 nM)

    • Plate setup: Technical triplicates for all samples and controls

    • Cycling conditions: Initial denaturation (95°C, 3 min), followed by 40 cycles of denaturation (95°C, 15 s) and annealing/extension (60°C, 30 s)

    • Melt curve analysis: Include for SYBR Green reactions to confirm amplicon specificity

  • Reference Gene Selection and Validation:

    • Candidate genes: Test multiple candidates (ACT2, UBQ10, EF1α, PP2A, TIP41)

    • Stability assessment: Use geNorm, NormFinder, or BestKeeper to evaluate expression stability

    • Validation across conditions: Ensure stability under experimental conditions being tested

    • Multiple reference genes: Use at least 3 validated reference genes for normalization

  • Data Analysis and Reporting:

    • Quantification method: Use the 2^(-ΔΔCT) method with appropriate reference gene normalization

    • Statistical analysis: Apply appropriate statistical tests (t-test, ANOVA) with multiple testing correction

    • Data presentation: Report both relative expression and statistical significance

    • Method reporting: Include detailed methods section with all parameters for reproducibility

  • Validation with Independent Methods:

    • RNA-Seq validation: Compare qPCR results with RNA-Seq data using AtRTD3 reference transcriptome

    • Protein-level confirmation: Validate expression changes at protein level where possible

    • Biological validation: Connect expression changes to phenotypic observations

This protocol should be optimized following adaptive experimental design principles . When encountering contradictory results between qPCR and other methods, implement the systematic reconciliation approach to resolve discrepancies .

How can researchers troubleshoot failed expression or purification of recombinant ATL33?

When encountering difficulties with recombinant ATL33 expression or purification, implement this systematic troubleshooting workflow:

  • Expression Troubleshooting:

    • Problem: No visible expression

      • Check plasmid sequence integrity through sequencing

      • Verify induction conditions (IPTG concentration, temperature, timing)

      • Test alternative expression strains (BL21(DE3)pLysS, Rosetta, Arctic Express)

      • Examine protein solubility in different cellular fractions (inclusion bodies may form)

      • Consider codon optimization for E. coli expression

    • Problem: Low expression levels

      • Optimize growth media (LB, TB, 2YT, auto-induction)

      • Adjust induction parameters (OD600 at induction, IPTG concentration)

      • Test expression at lower temperatures (18°C overnight) to improve folding

      • Add zinc (0.1 mM ZnCl2) to media to support RING domain formation

      • Consider fusion tags (MBP, SUMO) to enhance solubility

  • Solubility Enhancement Strategies:

    • Problem: Protein in inclusion bodies

      • Modify lysis buffer conditions (pH 7.0-8.5, NaCl 100-500 mM)

      • Add solubility enhancers (0.1% Triton X-100, 5-10% glycerol, 1 mM DTT)

      • Test various detergents (CHAPS, n-Dodecyl β-D-maltoside)

      • Consider on-column refolding protocols if denaturation is necessary

      • Implement co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Purification Optimization:

    • Problem: Poor binding to affinity resin

      • Verify tag accessibility (N vs. C-terminal positioning)

      • Optimize imidazole concentration in binding buffer (5-20 mM)

      • Adjust binding conditions (time, temperature, buffer pH)

      • Consider alternative affinity tags if His-tag is ineffective

      • Check for proteolytic cleavage using protease inhibitors

    • Problem: Co-purifying contaminants

      • Implement more stringent washing steps (higher imidazole, salt gradients)

      • Add secondary purification steps (ion exchange, size exclusion)

      • Consider on-column refolding to separate properly folded protein

      • Use ATP/MgCl2 washes to remove chaperone contaminants

  • Protein Stability Issues:

    • Problem: Protein aggregation during/after purification

      • Optimize buffer components (pH, salt concentration, additives)

      • Add stabilizing agents (10% glycerol, 1-5 mM DTT, 0.1 mM ZnCl2)

      • Determine optimal protein concentration to prevent concentration-dependent aggregation

      • Implement thermal shift assays to identify stabilizing conditions

      • Consider size exclusion chromatography as final polishing step

  • Activity Assessment:

    • Problem: Purified protein lacks activity

      • Verify proper folding through circular dichroism or limited proteolysis

      • Ensure zinc incorporation for RING-H2 domain functionality

      • Test activity with different E2 enzymes for ubiquitination assays

      • Optimize reaction conditions (temperature, pH, cofactors)

      • Consider tag removal if tag interferes with activity

Apply adaptive experimental design principles throughout this troubleshooting process , systematically testing variables to identify optimal conditions. Document all attempted approaches to facilitate resolution of contradictory outcomes .

What are the common challenges in analyzing ATL33 expression patterns and how can they be overcome?

Researchers face several challenges when analyzing ATL33 expression patterns, each requiring specific technical solutions:

  • Low Expression Level Detection:

    • Challenge: ATL33 may have low baseline expression, making detection difficult

    • Solutions:

      • Implement highly sensitive qPCR protocols with optimized primer efficiency

      • Use digital PCR for absolute quantification of low-abundance transcripts

      • Apply RNA amplification techniques for limited sample material

      • Consider nested PCR approaches for enhanced sensitivity

      • Utilize AtRTD3 or similar high-resolution transcriptome resources for accurate mapping

  • Tissue-Specific and Temporal Expression Patterns:

    • Challenge: Expression may be restricted to specific tissues or developmental stages

    • Solutions:

      • Conduct comprehensive sampling across tissues and developmental stages

      • Implement laser-capture microdissection for cell-type-specific analysis

      • Use fluorescent reporter constructs for in vivo visualization

      • Develop tissue-specific RNA isolation protocols

      • Apply single-cell RNA-Seq for cellular resolution of expression patterns

  • Distinguishing ATL33 from Related Family Members:

    • Challenge: High sequence similarity with other ATL family members may cause cross-reactivity

    • Solutions:

      • Design primers/probes targeting unique regions of ATL33

      • Validate specificity using knockdown/knockout lines

      • Implement RNA-Seq analysis with stringent mapping parameters

      • Use ATL33-specific antibodies for protein-level detection

      • Apply nuclease protection assays for isoform-specific detection

  • Contradictory Expression Data Across Platforms:

    • Challenge: Different detection methods may yield inconsistent results

    • Solutions:

      • Validate findings across multiple platforms (qPCR, RNA-Seq, microarray)

      • Apply the systematic reconciliation approach to resolve contradictions

      • Standardize normalization procedures across datasets

      • Implement meta-analysis techniques to integrate multiple studies

      • Consider biological factors that might explain genuine discrepancies

  • Environmental and Stress-Responsive Expression:

    • Challenge: Expression may be strongly influenced by environmental conditions

    • Solutions:

      • Carefully control and document growth conditions

      • Implement time-course sampling during stress treatments

      • Use positive controls (known stress-responsive genes)

      • Apply mixed models for statistical analysis to account for environmental variables

      • Develop standardized stress application protocols for reproducibility

  • Post-Transcriptional Regulation Analysis:

    • Challenge: Transcript levels may not correlate with protein abundance

    • Solutions:

      • Complement RNA analysis with protein detection methods

      • Investigate miRNA regulation of ATL33

      • Analyze transcript stability using actinomycin D treatment

      • Study alternative splicing patterns using isoform-specific detection

      • Implement polysome profiling to assess translation efficiency

For optimal experimental design, apply adaptive methodologies like DescRep to systematically address these challenges . When contradictory results emerge, implement the structured reconciliation approach to determine whether discrepancies reflect technical issues or genuine biological complexity .

How should researchers address potential redundancy and functional overlap when studying ATL33?

Addressing functional redundancy in ATL33 research requires a systematic, multi-level approach:

  • Comprehensive Phylogenetic Analysis:

    • Methodology: Construct detailed phylogenetic trees of the ATL family (80 members in Arabidopsis)

    • Analysis focus: Identify the closest paralogs to ATL33 based on sequence similarity

    • Implementation: Use maximum likelihood methods with appropriate substitution models

    • Output utilization: Prioritize related ATL genes for functional redundancy testing

    • Advanced approach: Incorporate synteny analysis to identify evolutionarily related genes

  • Expression Pattern Correlation:

    • Methodology: Compare expression patterns of ATL33 with related family members

    • Data sources: Use AtRTD3 or similar high-resolution transcriptome resources

    • Analysis techniques: Calculate expression correlation coefficients across tissues and conditions

    • Implementation: Generate co-expression networks to visualize relationships

    • Interpretation focus: Identify ATL genes with highly correlated expression patterns as potential functionally redundant genes

  • Multi-level Genetic Perturbation:

    • Single mutants: Generate and phenotype atl33 knockout lines

    • Double/higher-order mutants: Create combinations with phylogenetically related ATL genes

    • Artificial microRNA approach: Design amiRNAs targeting multiple family members simultaneously

    • Inducible RNAi: Develop systems for temporal control of gene silencing

    • CRISPR multiplexing: Target multiple ATL genes simultaneously

  • Domain-Specific Functional Analysis:

    • Domain swapping: Create chimeric proteins exchanging domains between ATL33 and related proteins

    • Conserved motif mutation: Systematically mutate shared motifs to identify functional regions

    • Interactome comparison: Compare protein interaction partners of ATL33 and related ATLs

    • Substrate specificity analysis: Determine overlapping and unique substrates among related ATLs

    • Structural analysis: Use homology modeling to identify structurally conserved regions

  • Complementation and Rescue Experiments:

    • Cross-complementation: Test whether related ATL genes can rescue atl33 mutant phenotypes

    • Domain-specific complementation: Use chimeric constructs to identify functional equivalence

    • Heterologous expression: Test functional conservation across plant species

    • Overexpression analysis: Determine if ATL33 overexpression affects expression of related genes

    • Inducible expression systems: Develop temporal control of complementation

  • Systems-Level Analysis:

    • Transcriptome profiling: Compare global expression changes in single and higher-order mutants

    • Protein-protein interaction networks: Map overlapping and unique interactions

    • Metabolomic profiling: Identify common metabolic pathways affected by ATL perturbations

    • Adaptive experimental design: Apply DescRep approach to optimize experimental parameters

    • Data integration: Develop comprehensive models of functional relationships among ATL family members

When implementing this framework, researchers should systematically document and address contradictory findings , recognizing that apparent contradictions may reveal important aspects of the complex functional relationships within the ATL family. The high number of ATL family members (80 in Arabidopsis) makes this systematic approach particularly important for meaningful functional characterization.

What emerging technologies might advance our understanding of ATL33 function?

Several cutting-edge technologies offer promising avenues for advancing ATL33 research:

  • CRISPR-Based Technologies:

    • CRISPRi/CRISPRa systems: For tunable repression or activation of ATL33 and related genes

    • Base editing: For precise introduction of point mutations without double-strand breaks

    • Prime editing: For targeted insertion, deletion, and replacement of specific sequences

    • CRISPR screening: For genome-wide identification of genetic interactions with ATL33

    • CRISPR-Cas13 systems: For targeted RNA degradation to study post-transcriptional regulation

  • Advanced Imaging Technologies:

    • Super-resolution microscopy: For subcellular localization at nanometer resolution

    • BiFC-PALM: Combining bimolecular fluorescence complementation with photoactivated localization microscopy

    • Light-sheet microscopy: For in vivo imaging of protein dynamics in plant tissues

    • FRET-FLIM: For quantitative analysis of protein-protein interactions in living cells

    • Correlative light and electron microscopy: For connecting protein localization with ultrastructural context

  • Protein Engineering and Structural Biology:

    • AlphaFold2 and RoseTTAFold: For accurate prediction of ATL33 structure and interactions

    • Cryo-EM: For high-resolution structural determination of ATL33 complexes

    • Hydrogen-deuterium exchange mass spectrometry: For mapping protein dynamics and interactions

    • Proximity labeling (BioID, APEX): For in vivo identification of protein interaction networks

    • Cross-linking mass spectrometry: For identification of transient interactions and binding interfaces

  • Single-Cell and Spatial Technologies:

    • Single-cell RNA-Seq: For cell-type-specific expression profiling

    • Spatial transcriptomics: For mapping ATL33 expression within tissue contexts

    • Single-cell proteomics: For cell-type-specific protein quantification

    • Spatially resolved proteomics: For mapping protein distribution within tissues

    • Single-cell chromatin accessibility: For understanding regulatory mechanisms

  • Systems Biology Approaches:

    • Multi-omics integration: For comprehensive modeling of ATL33 function

    • Network medicine approaches: For understanding ATL33 in the context of plant stress responses

    • Digital twin technology: For predictive modeling of ATL33 perturbation effects

    • Metabolic flux analysis: For quantifying the impact of ATL33 on metabolic pathways

    • Machine learning approaches: For pattern recognition in complex datasets

  • Synthetic Biology Tools:

    • Optogenetic control systems: For temporal regulation of ATL33 activity

    • Synthetic protein scaffolds: For manipulating ATL33 interaction networks

    • De novo protein design: For engineering ATL33 with novel functions

    • Biosensors: For real-time monitoring of ATL33 activity

    • Cell-free expression systems: For high-throughput testing of ATL33 variants

Each of these technologies should be implemented using adaptive experimental design approaches to maximize information gain while minimizing resource expenditure . When integrating data from multiple technological platforms, researchers should apply systematic reconciliation strategies to address potentially contradictory findings .

How might computational modeling contribute to our understanding of ATL33 function?

Computational modeling offers powerful approaches to enhance ATL33 research through multiple sophisticated methods:

  • Structural Modeling and Dynamics:

    • Homology modeling: Generate accurate ATL33 structural models using known RING-H2 domain structures

    • Molecular dynamics simulations: Analyze ATL33 conformational flexibility and domain movements

    • Protein-protein docking: Predict interaction interfaces between ATL33 and E2 enzymes or substrates

    • Free energy calculations: Quantify binding affinities and stability of protein complexes

    • Normal mode analysis: Identify collective motions important for ATL33 function

  • Network and Systems Modeling:

    • Gene regulatory network modeling: Integrate ATL33 into transcriptional networks

    • Protein interaction network analysis: Apply graph theory to identify ATL33's position in interaction networks

    • Bayesian network modeling: Infer causal relationships between ATL33 and other cellular components

    • Flux balance analysis: Predict metabolic consequences of ATL33 perturbation

    • Agent-based modeling: Simulate emergent properties of ATL33-mediated processes

  • Machine Learning Applications:

    • Substrate prediction algorithms: Develop tools to predict potential ATL33 ubiquitination targets

    • Expression pattern classification: Identify conditions where ATL33 is differentially regulated

    • Feature extraction from phenotypic data: Connect ATL33 perturbation to complex phenotypes

    • Transfer learning from related proteins: Leverage knowledge from better-characterized ATL proteins

    • Reinforcement learning for experimental design: Optimize experimental approaches based on previous outcomes

  • Multi-scale Modeling:

    • Molecular-to-cellular integration: Connect molecular interactions to cellular phenotypes

    • Tissue-level modeling: Simulate ATL33 function in the context of tissue organization

    • Whole-plant physiological models: Predict plant-level consequences of ATL33 perturbation

    • Evolutionary modeling: Analyze ATL family evolution and functional diversification

    • Environmental response simulation: Model ATL33's role in environmental adaptation

  • Specialized Ubiquitination Pathway Models:

    • E3 ligase specificity modeling: Predict substrate recognition determinants

    • Ubiquitin chain topology prediction: Model different ubiquitination patterns

    • Degradation kinetics simulation: Predict protein turnover rates mediated by ATL33

    • Competitive binding models: Simulate competition between different substrates

    • Pathway integration: Place ATL33 within larger ubiquitination network contexts

  • Experimental Design Optimization:

    • Implement DescRep methodologies: Apply stepwise adaptive approaches to experimental design

    • Bayesian optimization: Efficiently search experimental parameter space

    • Active learning approaches: Prioritize experiments that maximize information gain

    • In silico mutagenesis screening: Predict functional consequences of ATL33 mutations

    • Sensitivity analysis: Identify key parameters for experimental focus

These computational approaches should be implemented in an iterative cycle with experimental validation, using the systematic reconciliation framework to address any contradictions between computational predictions and experimental outcomes . This integration will accelerate understanding of ATL33 function while reducing experimental burden.

How might ATL33 research connect to broader plant adaptation and stress response mechanisms?

ATL33 research has significant potential to illuminate broader plant adaptation mechanisms through several interconnected pathways:

  • Stress Signaling Integration:

    • Ubiquitin-mediated regulation: ATL33 likely participates in rapid protein turnover during stress responses, similar to other ATL family members

    • Hormone signaling networks: Potential involvement in ABA signaling pathways, as suggested by ABA-insensitive phenotypes in related ATL mutants (ATL43)

    • Post-translational modification cascades: ATL33 may serve as a regulatory hub connecting multiple stress response pathways

    • Temporal dynamics control: Ubiquitin ligase activity could modulate the timing of stress responses

    • Signal amplification mechanisms: Targeted degradation of negative regulators could amplify stress signals

  • Environmental Adaptation Mechanisms:

    • Climate resilience pathways: ATL33 may regulate proteins involved in temperature, drought, or salinity responses

    • Photoperiodic adaptation: Potential role in protein turnover related to day length responses

    • Seasonal transitions: May participate in regulating seasonal developmental transitions

    • Stress memory mechanisms: Could be involved in priming responses for enhanced adaptation

    • Developmental plasticity: Might regulate developmental trajectories under variable environments

  • Biotic Stress Response Integration:

    • Plant immunity regulation: Potential involvement in pathogen recognition and response pathways

    • Pattern-triggered immunity: May regulate turnover of pattern recognition receptors or signaling components

    • Effector-triggered immunity: Could participate in R-protein stability or activity regulation

    • Systemic acquired resistance: Might mediate long-distance signaling protein turnover

    • Herbivore defense responses: Potential regulation of defense compound production pathways

  • Metabolic Adaptation Coordination:

    • Carbon allocation regulation: May influence protein stability in carbon partitioning pathways

    • Nitrogen use efficiency: Could regulate enzymes involved in nitrogen assimilation or remobilization

    • Secondary metabolite production: Might regulate key enzymes in defense compound synthesis

    • Energy homeostasis maintenance: Potential role in regulating metabolic enzyme stability under stress

    • Resource allocation shifts: May facilitate transition between growth and defense states

  • Evolutionary Adaptations:

    • Functional diversification: Analysis of ATL33 orthologs across species could reveal evolutionary adaptation patterns

    • Stress-specific specialization: Comparison with the 80 ATL family members in Arabidopsis could reveal stress-specific roles

    • Habitat-specific adaptation: ATL33 function may vary across ecotypes adapted to different environments

    • Co-evolutionary dynamics: May show co-evolution with specific pathogens or environmental factors

    • Domestication effects: Could reveal how artificial selection has impacted stress response mechanisms

  • Translational Applications:

    • Stress tolerance engineering: Manipulation of ATL33 might enhance resilience to specific stresses

    • Climate adaptation strategies: Knowledge of ATL33 function could inform climate adaptation breeding

    • Novel trait development: Understanding ATL33 regulation could enable engineering of novel stress responses

    • Sustainable agriculture approaches: May contribute to developing crops with reduced input requirements

    • Predictive phenotyping: ATL33 status could serve as a biomarker for stress response capacity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.