Recombinant Arabidopsis thaliana RING-H2 finger protein ATL38 (ATL38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ATL38; At2g34990; F19I3.22; RING-H2 finger protein ATL38; RING-type E3 ubiquitin transferase ATL38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL38
Target Protein Sequence
MVQPGTEIKASDLTLLVITIILFAIFIVGLASVCFRWTSRQFYSQESINPFTDSDVESRT SITAVRGLDEAIINSFPTFLYSEVKERRIGIGGVECAVCICEFEDHETLRLMPECCHVFH ADCVSVWLSDHSTCPLCRVDLCLQPGERSYLNPEPDLVESTNSHLFDGVTWTNRNRPSRS WSTRLSQCRVSQILISRSHSTGHSVVQPLDNLDRFTLRLPEEVRRQLTKKTVDNVAFSQA RSSRRGYRSRSAGSERSVFSYQRRMHSFSDCAWSTSCGGEAVAPSKDSRRISVEQSQLDD RV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G34990

STRING: 3702.AT2G34990.1

UniGene: At.62396

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL38 and how is it classified?

ATL38 (At2g34990) is a member of the Arabidopsis Tóxicos en Levadura (ATL) family of RING-H2 type ubiquitin ligases. It belongs to a large multigene family comprising 91 members in Arabidopsis thaliana that contain a particular variation of the RING finger domain called RING-H2 . These E3 ubiquitin ligases play crucial regulatory roles in protein degradation processes via the ubiquitin/26S proteasome pathway in eukaryotes . The ATL family is characterized by specific structural features including the RING-H2 domain, hydrophobic regions that likely function as transmembrane domains, and a conserved GLD motif (named after three conserved amino acids in the motif) .

How does ATL38 function as an E3 ubiquitin ligase?

As a RING-H2 type E3 ubiquitin ligase, ATL38 likely functions by binding directly to an E2 ubiquitin-conjugating enzyme through its RING-H2 domain. This binding facilitates the transfer of ubiquitin from the E2 enzyme to specific target substrates, marking them for degradation via the 26S proteasome . The mechanism generally involves:

  • Recognition of specific target proteins

  • Interaction with an E2 ubiquitin-conjugating enzyme (likely from the Ubc4/Ubc5 subfamily based on other ATL studies)

  • Facilitation of ubiquitin transfer to the target protein

  • Subsequent degradation of the ubiquitinated target by the 26S proteasome

Studies on other ATL family members have shown their interaction with E2 conjugating enzymes from the Ubc4/Ubc5 subfamily, and this is likely true for ATL38 as well .

What are the optimal methods for recombinant expression of ATL38?

Based on available data, ATL38 can be successfully expressed as a recombinant protein in E. coli with an N-terminal His-tag . The recommended approach includes:

  • Expression system: E. coli bacterial expression system

  • Construct design: Full-length ATL38 (amino acids 1-302) with an N-terminal His-tag for purification

  • Purification method: Affinity chromatography using the His-tag

  • Storage: The purified protein should be stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C

When designing expression constructs, consider that the hydrophobic N-terminal region may affect solubility, and alternative constructs excluding this region might improve protein yield and solubility in some experimental contexts.

What are the best practices for handling and storing recombinant ATL38?

For optimal handling and storage of recombinant ATL38:

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Long-term storage: Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C/-80°C.

  • Working conditions: Store working aliquots at 4°C for up to one week.

  • Stability considerations: Avoid repeated freeze-thaw cycles as they can compromise protein activity and integrity.

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How can in vitro ubiquitination assays be designed to assess ATL38 activity?

To evaluate the E3 ligase activity of recombinant ATL38, an in vitro ubiquitination assay can be designed based on protocols used for other ATL family members:

  • Components required:

    • Purified recombinant ATL38

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily)

    • Ubiquitin (unlabeled or labeled for detection)

    • ATP regeneration system

    • Buffer system (typically Tris-HCl pH 7.5, MgCl₂, DTT)

    • Putative substrate (if known)

  • Reaction conditions:

    • Incubation at 30°C for 1-2 hours

    • Termination with SDS-PAGE sample buffer

  • Detection methods:

    • Western blot analysis using anti-ubiquitin antibodies

    • If fluorescently or radioactively labeled ubiquitin is used, direct visualization

  • Controls:

    • Negative control: reaction mixture without E3 ligase

    • Positive control: known functional E3 ligase

    • RING domain mutant: to confirm RING-dependent activity

  • Analysis of substrate specificity:

    • If potential substrates are identified, include them in the reaction to assess specific ubiquitination .

How can potential substrates of ATL38 be identified?

Identifying potential substrates of ATL38 requires a multi-faceted approach:

  • Yeast two-hybrid screening:

    • Use ATL38 as bait to screen Arabidopsis cDNA libraries

    • Consider using versions lacking the transmembrane domain to avoid false negatives

    • Confirm interactions with co-immunoprecipitation experiments

  • Co-immunoprecipitation followed by mass spectrometry:

    • Express tagged ATL38 in Arabidopsis or other plant expression systems

    • Immunoprecipitate the protein complex

    • Identify co-precipitated proteins by mass spectrometry

  • Proximity-dependent biotin identification (BioID) or TurboID:

    • Fuse ATL38 to a biotin ligase

    • Express in plant cells to biotinylate proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Differential proteomics:

    • Compare proteome changes between wild-type and ATL38 overexpression/knockout lines

    • Focus on proteins with altered abundance or ubiquitination status

  • Bioinformatic prediction:

    • Compare with known substrates of related ATL proteins

    • Based on the function of ATL8 in sugar starvation response , consider proteins involved in carbohydrate metabolism as potential candidates

What are the predicted biological functions of ATL38 based on other ATL family members?

While specific information about ATL38 function is limited in the search results, we can make informed predictions based on related ATL proteins:

  • Stress response regulation: Several ATL family members are involved in plant responses to environmental stresses . ATL38 might similarly participate in stress signaling pathways.

  • Sugar metabolism: ATL8 has been implicated in sugar starvation responses and interacts with Starch Synthase 4 . ATL38 might also function in carbohydrate metabolism or energy homeostasis.

  • Developmental processes: Some ATL genes, like ATL8, are expressed in specific developmental contexts (e.g., siliques) suggesting roles in embryogenesis . ATL38 might have tissue-specific functions.

  • Hormone signaling: ATL43 shows an ABA-insensitive phenotype, suggesting involvement in hormone responses . ATL38 might similarly participate in hormone signaling networks.

  • Protein quality control: As a membrane-associated E3 ligase, ATL38 might participate in protein quality control pathways similar to the endoplasmic reticulum-associated degradation (ERAD) system .

How does ATL38 compare structurally and functionally with other ATL family members?

ATL38 shares key structural features with other ATL family proteins, but also has unique characteristics:

FeatureATL Family Common TraitsATL38 Specific Features
RING-H2 domain8 precisely spaced cysteine and histidine residues coordinating 2 zinc ionsPresent with conserved zinc ligands
Hydrophobic regionSingle transmembrane domain in most members; some have 2-3Single hydrophobic region at N-terminus
GLD motifHighly conserved region with unknown functionPresent, though specific conservation of key G and S residues would need verification
Gene structure90% are intronless genesConsistent with ATL family pattern
E2 interactionMost interact with Ubc4/Ubc5 subfamilyLikely follows the same pattern
Cellular localizationMembrane-bound compartmentsPredicted to localize to membranes based on hydrophobic region

ATL38's unique amino acid sequence likely confers specificity for particular substrates and regulatory contexts, distinguishing its function from other family members despite structural similarities .

What is the significance of ATL38's membrane localization, and how does it affect experimental approaches?

The predicted membrane localization of ATL38, based on its N-terminal hydrophobic domain, has important implications for research:

  • Biological significance:

    • Membrane localization can restrict substrate access to specific compartments

    • May indicate involvement in membrane protein quality control

    • Could suggest roles in signaling across membranes or in response to membrane-associated stimuli

  • Experimental considerations:

    • Protein extraction: Membrane protein extraction requires specialized buffers with detergents

    • Subcellular fractionation: Important to determine precise membrane localization (plasma membrane, ER, Golgi, etc.)

    • Live cell imaging: When using fluorescent protein fusions, verify that tagging doesn't disrupt membrane insertion

    • Activity assays: May need to include detergents or membrane mimetics to maintain native conformation and activity

    • Yeast two-hybrid: Traditional Y2H may fail due to membrane association; consider modified systems like split-ubiquitin Y2H

  • Methodological adaptations:

    • For recombinant expression, consider constructs lacking the transmembrane domain for improved solubility

    • When studying protein-protein interactions, use approaches compatible with membrane proteins (e.g., co-IP with crosslinking)

    • For localization studies, combine biochemical fractionation with microscopy approaches

How can CRISPR/Cas9 genome editing be used to study ATL38 function in Arabidopsis?

CRISPR/Cas9 genome editing offers powerful approaches to investigate ATL38 function:

  • Knockout strategies:

    • Design sgRNAs targeting early exons to create frameshift mutations

    • Screen for homozygous mutants and verify loss of protein expression

    • Assess phenotypes under various conditions (especially stress conditions)

    • Consider generating multiple independent knockout lines to confirm phenotypes

  • Domain-specific mutations:

    • Create precise mutations in functional domains (RING-H2, GLD motif) to study their importance

    • Design HDR templates for specific amino acid substitutions in zinc-coordinating residues

    • Compare phenotypes with complete knockout to distinguish domain-specific functions

  • Promoter editing:

    • Modify the native promoter to alter expression patterns

    • Add reporter genes for expression analysis

  • Tagged versions:

    • Insert epitope tags or fluorescent proteins in-frame at the genomic locus

    • Ensure tags don't interfere with protein function

    • Use for localization and interaction studies

  • Experimental design considerations:

    • Screen for conditions that induce ATL38 expression

    • Examine potential redundancy with other ATL family members

    • Consider creating multiple mutants if functional redundancy is suspected

    • Based on ATL8's role in sugar starvation , examine ATL38 mutants under varying carbon availability conditions

What approaches can resolve contradictory experimental results when studying ATL38?

When encountering contradictory results in ATL38 research, consider these systematic troubleshooting approaches:

  • Protein expression and localization verification:

    • Confirm protein expression levels in different experimental systems

    • Verify proper membrane localization using multiple approaches (fractionation, microscopy)

    • Ensure epitope tags don't interfere with localization or function

  • E3 ligase activity confirmation:

    • Test activity with different E2 enzymes (particularly from the Ubc4/Ubc5 subfamily)

    • Verify RING-H2 domain functionality through mutagenesis of key residues

    • Compare in vitro and in vivo ubiquitination results

  • Experimental conditions:

    • Test different developmental stages and tissues

    • Examine activity under various stress conditions

    • Consider temporal dynamics of protein interactions

  • Genetic background considerations:

    • Use multiple Arabidopsis ecotypes to account for genetic variation

    • Create complementation lines to confirm phenotype specificity

    • Consider functional redundancy with other ATL family members

  • Technical approach diversification:

    • Use orthogonal methods to verify key findings

    • Combine genetic, biochemical, and cell biological approaches

    • Develop quantitative assays for more precise measurements

  • Substrate validation:

    • Confirm direct interactions using multiple methods

    • Verify ubiquitination sites using mass spectrometry

    • Demonstrate biological relevance of the interaction through genetic studies

What are the major knowledge gaps in understanding ATL38 function?

Several significant gaps exist in our understanding of ATL38:

  • Substrate identification: The specific protein targets of ATL38 ubiquitination remain unknown. Identifying these substrates is critical for understanding its biological function.

  • Regulatory mechanisms: The factors that regulate ATL38 expression, localization, and activity have not been characterized. These may include transcriptional regulation, post-translational modifications, or protein-protein interactions.

  • Physiological role: The specific biological processes in which ATL38 participates remain undefined. While other ATL family members have been implicated in stress responses and developmental processes, ATL38's unique roles are unclear.

  • Subcellular localization: The precise membrane compartment where ATL38 resides has not been determined experimentally, limiting our understanding of its cellular context.

  • E2 enzyme specificity: While ATL family members typically interact with the Ubc4/Ubc5 subfamily of E2 enzymes, the specific E2 partners of ATL38 have not been verified.

  • Three-dimensional structure: The structure of ATL38, particularly its RING-H2 domain in complex with E2 enzymes or substrates, would provide valuable insights into its mechanism of action.

What innovative research approaches could advance understanding of ATL38?

Future research on ATL38 could benefit from these innovative approaches:

  • Proximity labeling proteomics: Techniques such as TurboID or APEX2 fusions could identify proteins in close proximity to ATL38 in vivo, helping to discover interacting partners and potential substrates.

  • Single-cell transcriptomics and proteomics: Analyzing ATL38 expression and function at the single-cell level could reveal cell type-specific roles that might be masked in whole-tissue analyses.

  • Structural biology: Cryo-EM or X-ray crystallography of ATL38 in complex with E2 enzymes and/or substrates would provide mechanistic insights into its function.

  • Synthetic biology approaches: Creating synthetic circuits with ATL38 could help define its functional parameters in controlled contexts.

  • Computational modeling: Molecular dynamics simulations of ATL38 interactions with E2 enzymes and potential substrates could guide experimental design.

  • CRISPR screens: Genome-wide CRISPR screens in Arabidopsis could identify genetic interactions with ATL38 and help place it in broader cellular pathways.

  • Developmental timing studies: Given the developmental roles of some ATL family members, high-resolution temporal studies of ATL38 function throughout plant development could be revealing.

  • Comparative studies across species: Examining ATL38 orthologs in other plant species could highlight conserved functions and species-specific adaptations.

How might ATL38 function in stress response pathways based on ATL family patterns?

Given the involvement of several ATL family members in stress responses, ATL38 may function in similar pathways:

  • Abiotic stress responses: ATL38 might target proteins for degradation in response to environmental stresses such as drought, salt, temperature, or light conditions. This could contribute to cellular adaptation by removing proteins that are detrimental under stress or by triggering signaling cascades.

  • Carbon/energy homeostasis: Similar to ATL8's role in sugar starvation response , ATL38 might participate in metabolic adjustments during energy limitation by regulating key metabolic enzymes or signaling components.

  • Hormone signaling integration: Like ATL43, which shows an ABA-insensitive phenotype , ATL38 could modulate hormone signaling pathways, potentially by targeting hormone receptors, signaling components, or transcription factors for degradation.

  • Protein quality control: As a membrane-associated E3 ligase, ATL38 might participate in the surveillance and removal of damaged or misfolded membrane proteins, particularly under stress conditions that promote protein damage.

  • Pathogen response: Some ATL family members respond to pathogen signals. ATL38 might similarly participate in plant immune responses by targeting defense-related proteins for activation or inhibitory factors for degradation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.