Recombinant Arabidopsis thaliana RING-H2 finger protein ATL39 (ATL39)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana RING-H2 finger protein ATL39 (ATL39) is a member of the ATL (Arabidopsis Tóxicos en Levadura) family of RING-H2 E3 ubiquitin ligases . These proteins are key components of the ubiquitination pathway, which regulates various cellular processes in plants, including stress responses, hormone signaling, and development . ATL39, encoded by the At4g09100 gene in Arabidopsis thaliana, contains a RING-H2 domain, which is a specialized type of zinc finger domain critical for E3 ligase activity .

Structure and Features

The ATL39 protein contains 132 amino acids . Key structural features include:

  • RING-H2 Domain: This domain contains a specific arrangement of cysteine and histidine residues that coordinate zinc ions, forming a cross-brace structure . The RING-H2 domain is essential for binding to E2 ubiquitin-conjugating enzymes, which facilitate the transfer of ubiquitin to target proteins .

  • Hydrophobic Region: ATLs typically have a hydrophobic region near the N-terminus, which may function as a transmembrane domain .

  • GLD Region: A highly conserved region of unknown function is present in ATLs .

The amino acid sequence of ATL39 is :
MSYFKRNEGTIVFAFASIGFIAFYIINYYIRRCRNRAAAAGDIEEARMSPRRPPRGLDAEAIKSFPSFVYTEARGIEPGIGELECVVCLNEFKDDETLRLVPPCVHVFHADCVDIWLSHSSTCPICRAKVVP

RING-H2 Finger Proteins

RING-finger proteins, particularly those of the RING-H2 type, are vital in plant biology . They constitute a substantial portion of E3 ubiquitin ligases, which are responsible for substrate specificity in the ubiquitination process . Arabidopsis thaliana has a large number of RING finger proteins, highlighting their importance in plant cellular functions .

Function

ATL39 is likely involved in plant defense signaling pathways . The Arabidopsis thaliana ATL family members participate in various processes:

  • Defense responses

  • Regulation of carbon and nitrogen balance during seedling growth

  • Regulation of programmed cell death during root development

  • Endosperm development

  • Transition to flowering

ATL proteins, including ATL39, function as E3 ubiquitin ligases, which facilitate the transfer of ubiquitin to target proteins . This ubiquitination can lead to protein degradation via the proteasome pathway or alter protein function, localization, or interactions .

The ATL Family

The Arabidopsis thaliana genome encodes 91 ATL proteins, named Arabidopsis Tóxicos en Levadura due to the initial identification of ATL2 as toxic when overexpressed in yeast . Not all ATL proteins are toxic to yeast; for example, only ATL63, apart from ATL2, has been shown to cause toxicity in yeast . ATL proteins share common structural features, including a RING-H2 domain and a hydrophobic region . They differ in their expression patterns, regulation, and specific functions . The ATL family has served as a model for studying gene family expansion in plant genomes .

E2 Enzyme Interaction

RING-H2 E3 ligases interact with E2 ubiquitin-conjugating enzymes to mediate ubiquitin transfer . The E2 enzyme Ubc4 is crucial for the function of some ATL proteins . For instance, the toxicity of ATL2 in yeast can be suppressed by mutations in Ubc4, indicating a functional interaction between ATL2 and Ubc4 .

Role in Defense Response

ATL2 is induced after exposure to chitin or inactivated crude cellulase preparations . The expression and induction of ATL9 depend on NADPH oxidases . Mutants of ATL9 show altered responses to the biotrophic fungus pathogen Golovinomyces cichoracearum . Overexpression of ATL9 leads to transgenic lines that are more resistant to this pathogen .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL39; At4g09100; F23J3.130; T8A17.4; RING-H2 finger protein ATL39; RING-type E3 ubiquitin transferase ATL39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL39
Target Protein Sequence
MSYFKRNEGTIVFAFASIGFIAFYIINYYIRRCRNRAAAAGDIEEARMSPRRPPRGLDAE AIKSFPSFVYTEARGIEPGIGELECVVCLNEFKDDETLRLVPPCVHVFHADCVDIWLSHS STCPICRAKVVP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G09100

STRING: 3702.AT4G09100.1

UniGene: At.54223

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should recombinant ATL39 be stored and handled?

Recombinant ATL39 protein should be stored at -20°C for routine storage. For extended preservation, conservation at -20°C or -80°C is recommended . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein .

Important handling considerations include:

  • Avoiding repeated freeze-thaw cycles as these can compromise protein integrity and activity

  • Preparing working aliquots that can be stored at 4°C for up to one week

  • When designing experiments, accounting for the protein's stability under your specific experimental conditions

This careful storage and handling approach helps maintain the structural integrity and functional activity of the recombinant protein for accurate experimental results.

What expression systems are suitable for producing recombinant ATL39?

Recombinant ATL39 can be produced using several expression systems, with E. coli being the most commonly employed for initial characterization studies. Based on protocols developed for similar plant proteins, the following methodological approach is recommended:

  • E. coli expression system:

    • Clone the ATL39 coding sequence into an expression vector containing an appropriate tag (His, GST, or Protein A)

    • Transform into an E. coli strain optimized for recombinant protein expression

    • Culture in 96-well plates for high-throughput screening applications

    • For Protein A fusion approaches, bacterial lysis followed by direct capture with immobilized immunoglobulin can be employed without extensive purification

  • Plant-based expression systems:

    • For studying functional interactions in a more native context, consider transient expression in Nicotiana benthamiana

    • Stable transformation of Arabidopsis thaliana mutant lines can be used for complementation studies

When designing your expression construct, consider that the tag type may need to be determined during the production process to optimize yield and solubility .

How can I design experiments to study ATL39's function in plant immunity?

ATL39 likely functions within the plant immune response network, similar to other RING-H2 proteins in Arabidopsis. To investigate its role, a comprehensive experimental approach should include:

Genetic analysis approach:

  • Obtain T-DNA insertion mutants for ATL39 from the Arabidopsis Biological Resource Center

  • Confirm knockout/knockdown by RT-PCR and Western blot analysis

  • Generate complementation and overexpression lines

  • Challenge plants with various pathogens to assess immune responses

Biochemical approach:

  • Express recombinant ATL39 and test its E3 ubiquitin ligase activity in vitro

  • Identify interaction partners using yeast two-hybrid or co-immunoprecipitation

  • Determine substrates for ubiquitination using proteomics approaches

Expression analysis:

  • Monitor ATL39 expression under different immune elicitors and pathogen challenges

  • Use qRT-PCR to quantify expression changes in various tissues and conditions

Consider using the helper NLR experimental frameworks as described for RNLs (ACTIVATED DISEASE RESISTANCE 1 and N REQUIREMENT GENE 1) to determine if ATL39 functions within similar immune signaling contexts, particularly in effector-triggered immunity (ETI) pathways.

What are the recommended methods for phenotypic analysis of ATL39 mutants?

When analyzing phenotypes of ATL39 mutant plants, a systematic approach examining multiple aspects of plant growth, development, and stress responses is recommended:

Developmental phenotyping:

  • Document growth parameters (height, leaf number, flowering time)

  • Analyze root architecture and development

  • Assess reproductive success (silique number, seed yield)

Stress response phenotyping:

  • Challenge plants with biotic stressors:

    • Bacterial pathogens (Pseudomonas syringae strains)

    • Fungal pathogens (Botrytis cinerea, powdery mildew)

    • Assess disease progression, bacterial growth, and fungal sporulation

  • Evaluate responses to abiotic stressors:

    • Drought tolerance (water withholding experiments)

    • Salt stress (growth on NaCl-supplemented media)

    • Oxidative stress (paraquat or H₂O₂ treatment)

Molecular phenotyping:

  • Analyze expression of defense marker genes by qRT-PCR

  • Measure accumulation of defense-related metabolites

  • Assess activation of defense signaling pathways via Western blot

For a comprehensive understanding, perform these analyses on multiple independent mutant lines and complementation lines to confirm phenotypes are specifically due to ATL39 disruption.

How does ATL39 function in relation to the NLR-mediated plant immune response?

Given that ATL39 is a RING-H2 finger protein in Arabidopsis, investigating its relationship to NLR-mediated immunity requires understanding the complex interplay between different immune receptors:

Experimental approach to assess NLR relationship:

  • Genetic interaction studies:

    • Cross atl39 mutants with known NLR mutants (both CNLs and TNLs)

    • Analyze double mutants for enhanced susceptibility or altered immune responses

    • Test interactions with ADR1 and NRG1 RNL families that act as helper NLRs

  • Temporal expression analysis:

    • Perform time-resolved transcriptome analysis similar to approaches used for RNL studies

    • Compare expression patterns between ATL39 and known NLR genes during infection

    • Create a timeline showing when ATL39 is activated relative to other immune components

  • Signal transduction investigation:

    • Determine if ATL39 functions downstream of sensor NLR activation

    • Assess whether ATL39 contributes to basal resistance or specifically to effector-triggered immunity

    • Test if TNL signaling requires ATL39 function

The approach should aim to position ATL39 within the established immune signaling network, determining whether it acts as an independent component or interfaces with the demonstrated unequally redundant functions of RNL families in basal resistance and ETI .

What automated approaches can be used for high-throughput ATL39 functional studies?

High-throughput studies of ATL39 function can leverage automated experimental design and execution pipelines. A recommended methodology based on current technologies includes:

Automated experimental pipeline:

  • Experiment design using Round-Trip architecture:

    • Define ATL39 constructs and experiment sample tables in a structured format

    • Convert these into a Structured Request Template with minimal requirements

    • Use automated systems to expand these into a complete Experiment Design with metadata for every measurement

  • High-throughput protein interaction screening:

    • Utilize 96-well plate formats for expressing ATL39 and potential interacting proteins

    • For T-cell recognition studies, express ATL39 as a fusion with protein A in E. coli microcultures

    • Following bacterial lysis, capture fusion proteins with immobilized immunoglobulin without further purification

  • Automated data analysis and integration:

    • Implement ETL (Extract, Transform, Load) processes to store experiment data

    • Compare expected versus actual experimental data to identify discrepancies

    • Annotate experimental requests with final data products

This approach provides many benefits, including connecting experimental data with deeply-represented constructs, filling in experimental details automatically, and flagging mismatches between expected and actual data for diagnosis .

How can I resolve contradictory data regarding ATL39 function?

When facing contradictory experimental results regarding ATL39 function, a systematic troubleshooting approach is essential:

Methodological approach to resolve contradictions:

  • Validate experimental materials:

    • Confirm gene knockout/knockdown by sequencing and expression analysis

    • Verify recombinant protein identity by mass spectrometry

    • Ensure antibody specificity with appropriate controls

  • Experimental context analysis:

    • Document all growth conditions precisely (light, temperature, humidity)

    • Consider plant developmental stage effects on ATL39 function

    • Evaluate potential redundancy with other ATL family members

  • Statistical resolution:

    Analysis ApproachApplication to ATL39 ResearchOutcome Measure
    Biological replicatesIndependent experiments with different seed batchesCoefficient of variation
    Technical replicatesMultiple measurements of the same biological sampleStandard error
    Meta-analysisIntegration of multiple datasets from different labsForest plot of effect sizes
    Power analysisDetermine appropriate sample size neededMinimum detectable effect
  • Cross-validate with orthogonal techniques:

    • If protein interaction results conflict, use multiple methods (Y2H, BiFC, Co-IP)

    • For phenotypic contradictions, employ both loss-of-function and gain-of-function approaches

    • Consider genetic background effects by testing in multiple Arabidopsis ecotypes

Remember that contradictory results often reveal biological complexity rather than experimental failure, potentially indicating condition-specific functions of ATL39.

What are the challenges in expressing and purifying functional recombinant ATL39?

Expressing and purifying functional RING-H2 finger proteins like ATL39 presents several specific challenges that researchers should anticipate and address:

Common challenges and solutions:

  • Protein solubility issues:

    • RING domains contain multiple cysteine and histidine residues that coordinate zinc atoms

    • Supplement expression media and buffers with ZnCl₂ (typically 10-100 μM)

    • Consider fusion tags that enhance solubility (MBP, SUMO) rather than just affinity tags

    • Express at lower temperatures (16-20°C) to improve folding

  • Maintaining E3 ligase activity:

    • The structural integrity of the RING domain is critical for function

    • Include reducing agents in purification buffers (1-5 mM DTT or β-mercaptoethanol)

    • Avoid freeze-thaw cycles that can compromise activity

    • Consider storing aliquots at 4°C for short-term use (up to one week)

  • Membrane association complications:

    • ATL39 contains hydrophobic regions that may associate with membranes

    • Include appropriate detergents (0.1% NP-40 or Triton X-100) during extraction

    • For functional studies, consider using microsomal fractions rather than purified protein

  • Protein yield optimization:

    • The tag type will need to be determined during the production process for optimal expression

    • Test multiple expression systems (bacterial, insect, plant) if E. coli yields are insufficient

    • Codon-optimize the sequence for the expression system being used

How can I design experiments to study ATL39's role in response to environmental stresses?

To investigate ATL39's role in environmental stress responses, a systematic research approach that integrates multiple levels of analysis is recommended:

Comprehensive stress response experimental design:

  • Transcriptional response analysis:

    • Perform qRT-PCR to measure ATL39 expression under various stresses:

      • Drought (polyethylene glycol treatment, soil water limitation)

      • Salt (NaCl treatment, 50-200 mM range)

      • Temperature extremes (cold 4°C, heat 37-42°C)

      • Oxidative stress (H₂O₂, paraquat, high light)

    • Create a temporal expression profile with multiple timepoints (0.5h, 1h, 3h, 6h, 24h)

  • Genetic approach:

    • Compare stress tolerance of wild-type, atl39 mutants, and ATL39-overexpression lines

    • Design construct series with site-directed mutations in key domains

    • Consider creating reporter lines with ATL39 promoter driving GUS or LUC for in vivo monitoring

  • Biochemical activity assessment:

    • Identify potential substrates that are ubiquitinated by ATL39 under stress conditions

    • Perform in vitro ubiquitination assays under conditions mimicking stress (altered pH, salt concentration)

    • Use protein stability assays to track substrate degradation dynamics

  • Systems biology integration:

    • Perform RNA-seq on wild-type vs. atl39 mutants under stress

    • Conduct proteomics to identify changes in the ubiquitinome

    • Use the data to construct network models of ATL39-mediated stress responses

This multi-faceted approach will help position ATL39 within the broader stress response networks in Arabidopsis, potentially revealing stress-specific functions and targets.

How does ATL39 function compare with other ATL family members in Arabidopsis?

The Arabidopsis thaliana genome encodes numerous ATL family members with diverse functions. A systematic comparative analysis of ATL39 with other family members provides valuable functional insights:

Comparative analysis framework:

  • Phylogenetic relationship assessment:

    • Construct a phylogenetic tree of all ATL family members

    • Identify the closest homologs to ATL39

    • Analyze conserved domains and motifs specific to different clades

  • Expression pattern comparison:

    • Create a comprehensive expression matrix across tissues and conditions

    • Identify co-expressed ATL genes that may have redundant functions

    • Determine unique expression contexts for ATL39

  • Functional complementation studies:

    • Test if other ATL proteins can rescue atl39 mutant phenotypes

    • Create chimeric proteins swapping domains between ATL39 and other family members

    • Assess which domains confer functional specificity

  • Comparative interactome analysis:

    • Identify common and unique interaction partners among ATL family members

    • Determine if substrate specificity differs between closely related ATLs

    • Map interaction networks to identify functional diversification

This comparative approach will reveal whether ATL39 has evolved unique functions or shares redundant roles with other family members, providing context for interpreting experimental results and designing further studies.

What can natural variation studies tell us about ATL39 function in different Arabidopsis ecotypes?

Natural variation studies offer powerful insights into protein function and adaptation. For ATL39, examining sequence and functional variation across Arabidopsis ecotypes can reveal important aspects of its biological role:

Natural variation research approach:

  • Sequence polymorphism analysis:

    • Compare ATL39 coding sequences across diverse Arabidopsis ecotypes

    • Identify non-synonymous SNPs that might affect protein function

    • Analyze promoter region variation that could affect expression

  • Expression variation assessment:

    • Quantify ATL39 expression levels in different ecotypes under standard and stress conditions

    • Determine if expression QTLs (eQTLs) exist for ATL39

    • Correlate expression patterns with specific environmental adaptations

  • Functional diversity characterization:

    • Compare biochemical activity of ATL39 variants from different ecotypes

    • Assess if substrate specificity varies across natural alleles

    • Determine if protein stability or localization differs between variants

  • Ecological correlation analysis:

    • Map ATL39 allelic distribution across geographical regions

    • Correlate allelic variants with specific environmental parameters

    • Test if certain variants confer adaptive advantages in specific conditions

Similar to studies performed with YELLOW SEEDLING1 (YS1) that revealed natural diversity in photosynthesis acclimation to high irradiance , natural variation studies of ATL39 could uncover cryptic functions and adaptive significance of different alleles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.