Arabidopsis thaliana RING-H2 finger protein ATL39 (ATL39) is a member of the ATL (Arabidopsis Tóxicos en Levadura) family of RING-H2 E3 ubiquitin ligases . These proteins are key components of the ubiquitination pathway, which regulates various cellular processes in plants, including stress responses, hormone signaling, and development . ATL39, encoded by the At4g09100 gene in Arabidopsis thaliana, contains a RING-H2 domain, which is a specialized type of zinc finger domain critical for E3 ligase activity .
The ATL39 protein contains 132 amino acids . Key structural features include:
RING-H2 Domain: This domain contains a specific arrangement of cysteine and histidine residues that coordinate zinc ions, forming a cross-brace structure . The RING-H2 domain is essential for binding to E2 ubiquitin-conjugating enzymes, which facilitate the transfer of ubiquitin to target proteins .
Hydrophobic Region: ATLs typically have a hydrophobic region near the N-terminus, which may function as a transmembrane domain .
GLD Region: A highly conserved region of unknown function is present in ATLs .
The amino acid sequence of ATL39 is :
MSYFKRNEGTIVFAFASIGFIAFYIINYYIRRCRNRAAAAGDIEEARMSPRRPPRGLDAEAIKSFPSFVYTEARGIEPGIGELECVVCLNEFKDDETLRLVPPCVHVFHADCVDIWLSHSSTCPICRAKVVP
RING-finger proteins, particularly those of the RING-H2 type, are vital in plant biology . They constitute a substantial portion of E3 ubiquitin ligases, which are responsible for substrate specificity in the ubiquitination process . Arabidopsis thaliana has a large number of RING finger proteins, highlighting their importance in plant cellular functions .
ATL39 is likely involved in plant defense signaling pathways . The Arabidopsis thaliana ATL family members participate in various processes:
ATL proteins, including ATL39, function as E3 ubiquitin ligases, which facilitate the transfer of ubiquitin to target proteins . This ubiquitination can lead to protein degradation via the proteasome pathway or alter protein function, localization, or interactions .
The Arabidopsis thaliana genome encodes 91 ATL proteins, named Arabidopsis Tóxicos en Levadura due to the initial identification of ATL2 as toxic when overexpressed in yeast . Not all ATL proteins are toxic to yeast; for example, only ATL63, apart from ATL2, has been shown to cause toxicity in yeast . ATL proteins share common structural features, including a RING-H2 domain and a hydrophobic region . They differ in their expression patterns, regulation, and specific functions . The ATL family has served as a model for studying gene family expansion in plant genomes .
RING-H2 E3 ligases interact with E2 ubiquitin-conjugating enzymes to mediate ubiquitin transfer . The E2 enzyme Ubc4 is crucial for the function of some ATL proteins . For instance, the toxicity of ATL2 in yeast can be suppressed by mutations in Ubc4, indicating a functional interaction between ATL2 and Ubc4 .
ATL2 is induced after exposure to chitin or inactivated crude cellulase preparations . The expression and induction of ATL9 depend on NADPH oxidases . Mutants of ATL9 show altered responses to the biotrophic fungus pathogen Golovinomyces cichoracearum . Overexpression of ATL9 leads to transgenic lines that are more resistant to this pathogen .
Recombinant ATL39 protein should be stored at -20°C for routine storage. For extended preservation, conservation at -20°C or -80°C is recommended . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein .
Important handling considerations include:
Avoiding repeated freeze-thaw cycles as these can compromise protein integrity and activity
Preparing working aliquots that can be stored at 4°C for up to one week
When designing experiments, accounting for the protein's stability under your specific experimental conditions
This careful storage and handling approach helps maintain the structural integrity and functional activity of the recombinant protein for accurate experimental results.
Recombinant ATL39 can be produced using several expression systems, with E. coli being the most commonly employed for initial characterization studies. Based on protocols developed for similar plant proteins, the following methodological approach is recommended:
E. coli expression system:
Clone the ATL39 coding sequence into an expression vector containing an appropriate tag (His, GST, or Protein A)
Transform into an E. coli strain optimized for recombinant protein expression
Culture in 96-well plates for high-throughput screening applications
For Protein A fusion approaches, bacterial lysis followed by direct capture with immobilized immunoglobulin can be employed without extensive purification
Plant-based expression systems:
For studying functional interactions in a more native context, consider transient expression in Nicotiana benthamiana
Stable transformation of Arabidopsis thaliana mutant lines can be used for complementation studies
When designing your expression construct, consider that the tag type may need to be determined during the production process to optimize yield and solubility .
ATL39 likely functions within the plant immune response network, similar to other RING-H2 proteins in Arabidopsis. To investigate its role, a comprehensive experimental approach should include:
Genetic analysis approach:
Obtain T-DNA insertion mutants for ATL39 from the Arabidopsis Biological Resource Center
Confirm knockout/knockdown by RT-PCR and Western blot analysis
Generate complementation and overexpression lines
Challenge plants with various pathogens to assess immune responses
Biochemical approach:
Express recombinant ATL39 and test its E3 ubiquitin ligase activity in vitro
Identify interaction partners using yeast two-hybrid or co-immunoprecipitation
Determine substrates for ubiquitination using proteomics approaches
Expression analysis:
Monitor ATL39 expression under different immune elicitors and pathogen challenges
Use qRT-PCR to quantify expression changes in various tissues and conditions
Consider using the helper NLR experimental frameworks as described for RNLs (ACTIVATED DISEASE RESISTANCE 1 and N REQUIREMENT GENE 1) to determine if ATL39 functions within similar immune signaling contexts, particularly in effector-triggered immunity (ETI) pathways.
When analyzing phenotypes of ATL39 mutant plants, a systematic approach examining multiple aspects of plant growth, development, and stress responses is recommended:
Developmental phenotyping:
Document growth parameters (height, leaf number, flowering time)
Analyze root architecture and development
Assess reproductive success (silique number, seed yield)
Stress response phenotyping:
Challenge plants with biotic stressors:
Bacterial pathogens (Pseudomonas syringae strains)
Fungal pathogens (Botrytis cinerea, powdery mildew)
Assess disease progression, bacterial growth, and fungal sporulation
Evaluate responses to abiotic stressors:
Drought tolerance (water withholding experiments)
Salt stress (growth on NaCl-supplemented media)
Oxidative stress (paraquat or H₂O₂ treatment)
Molecular phenotyping:
Analyze expression of defense marker genes by qRT-PCR
Measure accumulation of defense-related metabolites
Assess activation of defense signaling pathways via Western blot
For a comprehensive understanding, perform these analyses on multiple independent mutant lines and complementation lines to confirm phenotypes are specifically due to ATL39 disruption.
Given that ATL39 is a RING-H2 finger protein in Arabidopsis, investigating its relationship to NLR-mediated immunity requires understanding the complex interplay between different immune receptors:
Experimental approach to assess NLR relationship:
Genetic interaction studies:
Temporal expression analysis:
Signal transduction investigation:
The approach should aim to position ATL39 within the established immune signaling network, determining whether it acts as an independent component or interfaces with the demonstrated unequally redundant functions of RNL families in basal resistance and ETI .
High-throughput studies of ATL39 function can leverage automated experimental design and execution pipelines. A recommended methodology based on current technologies includes:
Automated experimental pipeline:
Experiment design using Round-Trip architecture:
High-throughput protein interaction screening:
Automated data analysis and integration:
This approach provides many benefits, including connecting experimental data with deeply-represented constructs, filling in experimental details automatically, and flagging mismatches between expected and actual data for diagnosis .
When facing contradictory experimental results regarding ATL39 function, a systematic troubleshooting approach is essential:
Methodological approach to resolve contradictions:
Validate experimental materials:
Confirm gene knockout/knockdown by sequencing and expression analysis
Verify recombinant protein identity by mass spectrometry
Ensure antibody specificity with appropriate controls
Experimental context analysis:
Document all growth conditions precisely (light, temperature, humidity)
Consider plant developmental stage effects on ATL39 function
Evaluate potential redundancy with other ATL family members
Statistical resolution:
| Analysis Approach | Application to ATL39 Research | Outcome Measure |
|---|---|---|
| Biological replicates | Independent experiments with different seed batches | Coefficient of variation |
| Technical replicates | Multiple measurements of the same biological sample | Standard error |
| Meta-analysis | Integration of multiple datasets from different labs | Forest plot of effect sizes |
| Power analysis | Determine appropriate sample size needed | Minimum detectable effect |
Cross-validate with orthogonal techniques:
If protein interaction results conflict, use multiple methods (Y2H, BiFC, Co-IP)
For phenotypic contradictions, employ both loss-of-function and gain-of-function approaches
Consider genetic background effects by testing in multiple Arabidopsis ecotypes
Remember that contradictory results often reveal biological complexity rather than experimental failure, potentially indicating condition-specific functions of ATL39.
Expressing and purifying functional RING-H2 finger proteins like ATL39 presents several specific challenges that researchers should anticipate and address:
Common challenges and solutions:
Protein solubility issues:
RING domains contain multiple cysteine and histidine residues that coordinate zinc atoms
Supplement expression media and buffers with ZnCl₂ (typically 10-100 μM)
Consider fusion tags that enhance solubility (MBP, SUMO) rather than just affinity tags
Express at lower temperatures (16-20°C) to improve folding
Maintaining E3 ligase activity:
Membrane association complications:
ATL39 contains hydrophobic regions that may associate with membranes
Include appropriate detergents (0.1% NP-40 or Triton X-100) during extraction
For functional studies, consider using microsomal fractions rather than purified protein
Protein yield optimization:
To investigate ATL39's role in environmental stress responses, a systematic research approach that integrates multiple levels of analysis is recommended:
Comprehensive stress response experimental design:
Transcriptional response analysis:
Perform qRT-PCR to measure ATL39 expression under various stresses:
Drought (polyethylene glycol treatment, soil water limitation)
Salt (NaCl treatment, 50-200 mM range)
Temperature extremes (cold 4°C, heat 37-42°C)
Oxidative stress (H₂O₂, paraquat, high light)
Create a temporal expression profile with multiple timepoints (0.5h, 1h, 3h, 6h, 24h)
Genetic approach:
Compare stress tolerance of wild-type, atl39 mutants, and ATL39-overexpression lines
Design construct series with site-directed mutations in key domains
Consider creating reporter lines with ATL39 promoter driving GUS or LUC for in vivo monitoring
Biochemical activity assessment:
Identify potential substrates that are ubiquitinated by ATL39 under stress conditions
Perform in vitro ubiquitination assays under conditions mimicking stress (altered pH, salt concentration)
Use protein stability assays to track substrate degradation dynamics
Systems biology integration:
Perform RNA-seq on wild-type vs. atl39 mutants under stress
Conduct proteomics to identify changes in the ubiquitinome
Use the data to construct network models of ATL39-mediated stress responses
This multi-faceted approach will help position ATL39 within the broader stress response networks in Arabidopsis, potentially revealing stress-specific functions and targets.
The Arabidopsis thaliana genome encodes numerous ATL family members with diverse functions. A systematic comparative analysis of ATL39 with other family members provides valuable functional insights:
Comparative analysis framework:
Phylogenetic relationship assessment:
Construct a phylogenetic tree of all ATL family members
Identify the closest homologs to ATL39
Analyze conserved domains and motifs specific to different clades
Expression pattern comparison:
Create a comprehensive expression matrix across tissues and conditions
Identify co-expressed ATL genes that may have redundant functions
Determine unique expression contexts for ATL39
Functional complementation studies:
Test if other ATL proteins can rescue atl39 mutant phenotypes
Create chimeric proteins swapping domains between ATL39 and other family members
Assess which domains confer functional specificity
Comparative interactome analysis:
Identify common and unique interaction partners among ATL family members
Determine if substrate specificity differs between closely related ATLs
Map interaction networks to identify functional diversification
This comparative approach will reveal whether ATL39 has evolved unique functions or shares redundant roles with other family members, providing context for interpreting experimental results and designing further studies.
Natural variation studies offer powerful insights into protein function and adaptation. For ATL39, examining sequence and functional variation across Arabidopsis ecotypes can reveal important aspects of its biological role:
Natural variation research approach:
Sequence polymorphism analysis:
Compare ATL39 coding sequences across diverse Arabidopsis ecotypes
Identify non-synonymous SNPs that might affect protein function
Analyze promoter region variation that could affect expression
Expression variation assessment:
Quantify ATL39 expression levels in different ecotypes under standard and stress conditions
Determine if expression QTLs (eQTLs) exist for ATL39
Correlate expression patterns with specific environmental adaptations
Functional diversity characterization:
Compare biochemical activity of ATL39 variants from different ecotypes
Assess if substrate specificity varies across natural alleles
Determine if protein stability or localization differs between variants
Ecological correlation analysis:
Map ATL39 allelic distribution across geographical regions
Correlate allelic variants with specific environmental parameters
Test if certain variants confer adaptive advantages in specific conditions
Similar to studies performed with YELLOW SEEDLING1 (YS1) that revealed natural diversity in photosynthesis acclimation to high irradiance , natural variation studies of ATL39 could uncover cryptic functions and adaptive significance of different alleles.