Recombinant Arabidopsis thaliana RING-H2 finger protein ATL3 (ATL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ATL3; At1g72310; T10D10.22; T9N14.21; RING-H2 finger protein ATL3; RING-type E3 ubiquitin transferase ATL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL3
Target Protein Sequence
MDDNRSTHSSMFGDLSTEEVTSKIILTAIIVLFMAVLFVLILHLYAKLYWWRIDQLQQQQ QQQQQEQEQEEDQSSIAPPVVTRRQRRRFIFVPGQDALSNTGLTSFELSSLPIVFFRQDS CKDGLECSICLSELVKGDKARLLPKCNHSFHVECIDMWFQSHSTCPICRNTVLGPEQASS KRVEQVPDNAENAGTTNNNHDALSQLSTSSPEFPTNVLVWGRQDQVSTGNTNVGTQEDGA AGNGASQSQEAVVLDISDSSSRNHNVSSSSSSMRFIVEEEEAKSPMTTRLRSLRRFLSRD KRVGCSNSSTSNSSSSNAVASVDP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G72310

STRING: 3702.AT1G72310.1

UniGene: At.11694

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the recommended laboratory conditions for working with recombinant ATL3 protein?

Recombinant ATL3 protein requires specific handling conditions to maintain stability and activity. The lyophilized powder form should be stored at -20°C to -80°C upon receipt . When working with the protein, it is advisable to reconstitute it in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For optimal stability:

  • Add 5-50% glycerol (final concentration) to prevent freeze-thaw damage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C to -80°C with 50% glycerol

The protein is optimally stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain its structural integrity .

What are the most effective protocols for studying protein-protein interactions involving ATL3?

Several methodologies can be employed to study ATL3 protein interactions:

Yeast Two-Hybrid (Y2H) Screening:

  • Clone the full-length ATL3 coding sequence (1-324aa) into a bait vector

  • Screen against an Arabidopsis cDNA library

  • Validate potential interactions through targeted Y2H assays

  • Consider domain-specific interactions by creating truncated constructs of ATL3

Co-Immunoprecipitation (Co-IP):

  • Use the recombinant His-tagged ATL3 protein as bait

  • Add plant lysate containing potential interacting partners

  • Purify using Ni-NTA resin to capture His-tagged ATL3 and its interactors

  • Analyze co-precipitated proteins by mass spectrometry

Bimolecular Fluorescence Complementation (BiFC):

  • Create fusion constructs of ATL3 with the N-terminal half of a fluorescent protein

  • Fuse candidate interacting proteins with the C-terminal half

  • Co-express in plant protoplasts or by Agrobacterium-mediated transformation

  • Visualize interactions through fluorescence microscopy

How can researchers optimize expression and purification of recombinant ATL3 protein?

Based on commercial production approaches, the following protocol can be implemented:

Expression Optimization:

  • Transform E. coli expression strain (BL21(DE3) recommended) with a vector containing the ATL3 gene fused to an N-terminal His-tag

  • Test expression at different temperatures (16°C, 25°C, and 37°C)

  • Vary IPTG concentrations (0.1 mM to 1.0 mM) for induction

  • Determine optimal induction time (4-24 hours)

Purification Protocol:

  • Harvest cells and lyse in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors

  • Clear lysate by centrifugation (20,000g for 30 minutes)

  • Apply supernatant to Ni-NTA column pre-equilibrated with lysis buffer

  • Wash with 20-50 mM imidazole to remove non-specific binding

  • Elute with 250-500 mM imidazole

  • Dialyze against storage buffer (Tris/PBS with 6% Trehalose, pH 8.0)

  • Assess purity by SDS-PAGE (should be >90%)

How is ATL3 involved in plant stress response pathways?

ATL3, as a RING-type E3 ubiquitin transferase, likely plays roles in protein turnover related to stress responses. While specific ATL3 research data is limited in the provided materials, similar RING-finger proteins in Arabidopsis have been implicated in:

  • Abiotic stress responses:

    • Regulation of drought tolerance through targeted degradation of signaling components

    • Salt stress adaptation via modulation of ion transporters

    • Temperature stress response through degradation of heat shock proteins

  • Biotic stress pathways:

    • Defense against pathogens through degradation of negative regulators

    • Hormone signaling modulation during pathogen attack

To study ATL3's specific roles in stress responses, researchers should consider:

  • Creating knockout/knockdown lines using CRISPR-Cas9 or RNAi

  • Performing stress tolerance assays comparing wild-type and ATL3-modified plants

  • Identifying transcriptional changes during stress using RNA-seq

  • Identifying ubiquitination targets that change in abundance in ATL3 mutants under stress conditions

What is known about genetic variation in ATL3 across different Arabidopsis ecotypes?

While the search results don't provide ecotype-specific information about ATL3, research approaches to study natural variation would include:

  • Comparative sequence analysis:

    • Align ATL3 sequences from diverse Arabidopsis accessions

    • Identify SNPs and structural variations

    • Correlate polymorphisms with environmental adaptations

  • Functional variation assessment:

    • Express ATL3 variants from different ecotypes in a common genetic background

    • Assess differences in stress tolerance, development, or other phenotypes

    • Perform complementation studies in ATL3 knockout lines

The structural variations observed in other Arabidopsis genes, as seen in pollen killer loci , suggest that ATL3 might also display significant natural variation, potentially including gene duplications and rearrangements that could affect its function across ecotypes.

How does ATL3 relate to other proteins in the Arabidopsis RING-finger family?

The Arabidopsis genome contains numerous RING-finger proteins with diverse functions. ATL3 belongs to the ATL (Arabidopsis Tóxicos en Levadura) family, which includes several RING-type E3 ubiquitin ligases. Research approaches to understand ATL3's relationship within this family include:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of all ATL family proteins

    • Identify conserved domains and evolutionary relationships

    • Map functional diversification within the family

  • Expression pattern comparison:

    • Analyze tissue-specific and stress-responsive expression patterns

    • Identify co-expression networks for different ATL proteins

    • Determine unique vs. redundant expression contexts

  • Substrate specificity:

    • Perform comparative ubiquitination assays to identify unique vs. shared targets

    • Analyze structural differences in substrate recognition domains

    • Conduct domain-swapping experiments to map specificity determinants

What techniques are most effective for studying ATL3's role in the ubiquitin-proteasome pathway?

To elucidate ATL3's specific function in the ubiquitin-proteasome system, researchers should consider the following methodologies:

  • In vitro ubiquitination assays:

    • Purify recombinant His-tagged ATL3 (as available commercially)

    • Combine with E1, E2 enzymes, ubiquitin, ATP, and potential substrates

    • Detect ubiquitinated products via western blotting

    • Compare wild-type ATL3 with site-directed mutants targeting the RING domain

  • Identification of E2 partners:

    • Test interactions with various Arabidopsis E2 enzymes using Y2H or pull-down assays

    • Assess functional cooperation through in vitro reconstitution experiments

    • Confirm in vivo using BiFC or co-immunoprecipitation

  • Substrate identification:

    • Perform immunoprecipitation of ATL3 followed by mass spectrometry

    • Compare proteomes of wild-type and ATL3 mutant plants

    • Use proximity-dependent biotin identification (BioID) with ATL3 as bait

    • Validate candidates through direct interaction and ubiquitination assays

What are common pitfalls when working with recombinant ATL3 protein and how can they be addressed?

Researchers working with recombinant ATL3 protein may encounter several challenges:

ChallengePotential CauseSolution
Low protein solubilityHydrophobic transmembrane domainExpress truncated versions lacking the membrane domain; use detergents in buffer
Poor expression yieldCodon bias, protein toxicityOptimize codon usage for E. coli; use tightly controlled inducible systems
Protein aggregationImproper foldingExpress at lower temperatures (16-18°C); add folding chaperones; include zinc in buffers
Loss of activity after purificationImproper storage, oxidation of cysteinesAdd reducing agents; store with glycerol; aliquot to avoid freeze-thaw cycles
Protein degradationProtease contaminationInclude multiple protease inhibitors; reduce purification time

To minimize these issues, follow the recommended storage and handling protocols: store as aliquots at -20°C/-80°C in buffer containing 6% Trehalose at pH 8.0, with 50% glycerol for long-term storage .

How can researchers validate that recombinant ATL3 retains its native biological activity?

Confirming that recombinant ATL3 maintains its E3 ligase activity is crucial for experimental validity. Recommended validation approaches include:

  • Functional ubiquitination assay:

    • Perform in vitro ubiquitination using purified components

    • Compare activity of recombinant ATL3 with immunoprecipitated native ATL3

    • Verify ubiquitin chain formation using mass spectrometry

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Zinc content analysis to confirm proper metal coordination

    • Limited proteolysis to verify correct folding

  • Binding partner validation:

    • Pull-down assays with known interactors

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Compare binding profiles of recombinant vs. native protein

How might ATL3 function relate to mitochondrial biology in Arabidopsis?

While direct evidence linking ATL3 to mitochondrial function isn't provided in the search results, research on other Arabidopsis proteins suggests potential connections:

  • Mitochondrial protein quality control:

    • Investigate if ATL3 targets mitochondrial proteins for degradation

    • Examine ATL3 localization using fluorescent protein fusions

    • Compare mitochondrial morphology and function in wild-type vs. ATL3 mutant plants

  • Connection to chimeric mitochondrial proteins:

    • The search results mention a chimeric protein addressed to mitochondria involved in pollen development

    • Explore potential interactions between ATL3 and mitochondrial-targeted proteins

    • Investigate ATL3's role in pollen development and function

  • Stress response coordination:

    • Study how ATL3-mediated ubiquitination might coordinate nuclear and mitochondrial responses to stress

    • Examine retrograde signaling pathways and their potential regulation by ATL3

Research methods should include subcellular fractionation, co-localization studies, and comparative proteomics between wild-type and ATL3 mutant mitochondria.

What are the latest approaches for studying structural dynamics of RING-finger proteins like ATL3?

Advanced structural biology techniques for studying ATL3 include:

  • Cryo-electron microscopy (Cryo-EM):

    • Visualize ATL3 alone and in complex with E2 enzymes or substrates

    • Capture different conformational states during the ubiquitination cycle

    • Resolve structures at near-atomic resolution

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Determine solution structure of isolated RING domains

    • Study dynamics and flexibility of the protein

    • Map interaction surfaces with binding partners

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probe conformational changes upon substrate or E2 binding

    • Identify regions of stability and flexibility

    • Compare wild-type and mutant forms of ATL3

  • Molecular dynamics simulations:

    • Model ATL3 structure based on homologous proteins

    • Simulate ligand binding and conformational changes

    • Predict effects of mutations on structure and function

These advanced approaches can provide critical insights into how ATL3's structure enables its specific functions in the ubiquitin pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.