Recombinant Arabidopsis thaliana RING-H2 finger protein ATL40 (ATL40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL40; At2g42350; MHK10.7; RING-H2 finger protein ATL40; RING-type E3 ubiquitin transferase ATL40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL40
Target Protein Sequence
MSSNNKTDDSDDRSFWQNSTSYDASSKIFLVTTVSFSIIIIIVFVYYLYAKFVLHRRSAF QDLSFSVVSQPPKRGLDSLVIASLPTFVVGIKNDVAGTECAVCLSLLEEKDNARMLPNCK HVFHVSCVDTWLTTQSTCPVCRTEAEPSHPRLEPEPREGPVGDFAPPLDFAGVDNKTGGS SVSRLDSFRRILTRERSSNRRDHSRVDQDRELDIERQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G42350

STRING: 3702.AT2G42350.1

UniGene: At.42716

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL40 and how does it relate to the broader ATL family in Arabidopsis thaliana?

ATL40 is a member of the ATL (Arabidopsis Toxicos en Levadura) gene family that encodes RING-H2 finger domain proteins functioning as ubiquitin ligases in Arabidopsis thaliana. The ATL family comprises approximately 80 members in A. thaliana, with ATL40 being one of these members. As part of this family, ATL40 plays a regulatory role in protein degradation processes via the ubiquitin/26S proteasome pathway. The ATL family is characterized by a specific RING-H2 finger domain that mediates the transfer of ubiquitin to target proteins, thereby participating in substrate specification for protein degradation . Most ATL genes (approximately 90%) are intronless, suggesting that the basic ATL protein structure evolved as a functional module, with ATL40 likely sharing this characteristic genomic organization .

What are the conserved structural features of ATL40 as a RING-H2 finger protein?

As a RING-H2 finger protein, ATL40 contains a characteristic zinc-finger domain with a specific arrangement of cysteine and histidine residues that coordinate zinc ions. The canonical RING-H2 finger domain in ATL proteins follows the pattern C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C, where C represents cysteine, H represents histidine, and X represents any amino acid with the subscript indicating the number of residues. This domain is critical for the ubiquitin ligase activity of ATL40, as it facilitates interactions with E2 ubiquitin-conjugating enzymes during the ubiquitination process . Additionally, ATL proteins typically contain a transmembrane domain at the N-terminus and a variable C-terminal region that likely determines substrate specificity, features that ATL40 would share with other family members.

How does ATL40 function in the ubiquitin/26S proteasome pathway?

ATL40, like other ATL family members, functions as an E3 ubiquitin ligase within the ubiquitin/26S proteasome pathway. In this pathway, ATL40 would catalyze the final step of the ubiquitination cascade by facilitating the transfer of ubiquitin molecules from an E2 ubiquitin-conjugating enzyme to specific substrate proteins. The RING-H2 finger domain of ATL40 is essential for this activity, as it serves as a scaffold that brings the E2 enzyme and substrate into proximity. Once the substrate protein is polyubiquitinated, it becomes recognizable by the 26S proteasome complex, which subsequently degrades the protein . Through this mechanism, ATL40 contributes to the regulation of protein turnover and cellular homeostasis in Arabidopsis thaliana, potentially affecting various biological processes depending on its specific substrate targets.

What are the typical expression patterns of ATL40 in different tissues and developmental stages?

The expression of ATL40, like other ATL family members, may show tissue specificity and developmental regulation. While specific expression data for ATL40 is not detailed in the search results, research on other ATL genes suggests differential expression patterns. For instance, ATL8 was found to be mainly expressed in young siliques, suggesting a role during embryogenesis . By analogy, ATL40 expression patterns would be an important area of investigation to understand its biological function. Researchers should consider using techniques such as quantitative real-time PCR (qRT-PCR), RNA-seq, or reporter gene constructs (such as ATL40 promoter:GUS fusions) to characterize the expression profile of ATL40 across different tissues (roots, leaves, stems, flowers, siliques) and developmental stages. Additionally, examining expression under various environmental conditions and stresses would provide insights into the regulatory contexts of ATL40 function.

How is ATL40 expression regulated in response to environmental stresses and hormonal signals?

Many ATL family members show responsiveness to environmental stresses and hormonal signals. For example, some ATL genes are regulated in response to dark treatment, abscisic acid (ABA), salicylic acid, and pathogen attack, as observed with AtS40-3 . Although specific data for ATL40 regulation is not provided in the search results, it would be valuable to investigate its expression in response to various abiotic stresses (drought, cold, heat, salinity), biotic stresses (pathogen infection), and plant hormones (ABA, ethylene, jasmonic acid, salicylic acid). Methodologically, researchers could use qRT-PCR or RNA-seq to quantify ATL40 transcript levels under different treatment conditions compared to controls. Additionally, analysis of the ATL40 promoter region for cis-regulatory elements could provide insights into transcription factor binding sites that mediate stress and hormone responses. Such studies would help elucidate the regulatory network controlling ATL40 expression and its potential role in stress adaptation.

What are the recommended methods for recombinant expression and purification of ATL40 protein?

For recombinant expression and purification of ATL40, researchers should consider the following methodological approach:

  • Expression system selection: E. coli is often used for initial expression attempts, but given that ATL40 is a eukaryotic protein with potential post-translational modifications, yeast (Saccharomyces cerevisiae or Pichia pastoris) or insect cell (Sf9 or Sf21) systems may provide better folding and activity.

  • Construct design:

    • For bacterial expression, consider removing the N-terminal transmembrane domain to improve solubility

    • Include fusion tags (His6, GST, MBP) to facilitate purification and potentially enhance solubility

    • Design constructs with and without the RING-H2 domain to assess functional roles

  • Expression optimization:

    • Test multiple expression temperatures (16°C, 25°C, 30°C)

    • Vary induction conditions (IPTG concentration, induction time)

    • Include zinc supplementation (50-100 μM ZnCl2) in growth media to ensure proper folding of the RING-H2 domain

  • Purification strategy:

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to ensure homogeneity

    • Consider adding reducing agents (DTT or β-mercaptoethanol) and zinc in buffers to maintain RING domain integrity

  • Activity verification:

    • In vitro ubiquitination assays to confirm E3 ligase activity

    • Interaction studies with potential E2 enzymes using pull-down assays

These approaches should be optimized based on preliminary results and the specific experimental goals for studying ATL40.

How can I design effective gene knockout or knockdown strategies for ATL40 functional studies?

Designing effective gene knockout or knockdown strategies for ATL40 functional studies requires careful consideration of multiple approaches:

  • T-DNA insertion lines:

    • Screen available T-DNA insertion collections (SALK, SAIL, GABI) for insertions in ATL40

    • Verify homozygosity using PCR-based genotyping with gene-specific and T-DNA border primers

    • Confirm knockdown/knockout by RT-PCR and qRT-PCR

    • Consider that complete knockout may be lethal if ATL40 is essential, as observed with some ATL family members

  • CRISPR/Cas9 genome editing:

    • Design sgRNAs targeting early exon regions or critical functional domains

    • Use multiple sgRNAs to increase editing efficiency

    • Screen for frameshift mutations that disrupt protein function

    • Consider generating conditional knockouts if complete knockout is lethal

  • RNAi-mediated knockdown:

    • Design constructs targeting unique regions of ATL40 to avoid off-target effects

    • Use inducible promoters (e.g., estradiol-inducible) for temporal control

    • Quantify knockdown efficiency by qRT-PCR

  • Artificial microRNA (amiRNA):

    • Design amiRNAs targeting ATL40-specific sequences

    • Use tissue-specific or inducible promoters for spatial and temporal regulation

  • Verification strategies:

    • Confirm specificity by assessing expression of closely related ATL family members

    • Perform complementation with wild-type ATL40 to verify phenotype causality

    • Consider redundancy with other ATL genes when interpreting results

Each approach has advantages and limitations, and the optimal strategy depends on research objectives, available resources, and whether ATL40 is essential for plant viability.

What are the best experimental designs for studying ATL40 substrate specificity?

Studying the substrate specificity of ATL40 requires well-designed experimental approaches to identify, validate, and characterize its target proteins. Consider the following comprehensive strategy:

  • Proteome-wide identification approaches:

    • Yeast two-hybrid screening using ATL40 as bait (consider using variants lacking the transmembrane domain)

    • Tandem affinity purification coupled with mass spectrometry (TAP-MS) using epitope-tagged ATL40

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

  • Validation of direct interactions:

    • In vitro pull-down assays with recombinant proteins

    • Co-immunoprecipitation from plant extracts

    • Bimolecular fluorescence complementation (BiFC) in planta

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Ubiquitination assays:

    • In vitro reconstitution with purified E1, E2, ATL40, and candidate substrates

    • Detection of ubiquitinated substrates via western blotting

    • Mass spectrometry to identify ubiquitination sites

  • Domain mapping and specificity determinants:

    • Create ATL40 variants with mutations in key regions

    • Test substrate recognition using truncated or chimeric ATL40 proteins

    • Compare with closely related ATL family members to identify specificity regions

  • Physiological relevance verification:

    • Monitor substrate protein levels in ATL40 knockout/overexpression lines

    • Assess substrate stability using cycloheximide chase assays

    • Examine co-localization of ATL40 and substrates in planta

This multifaceted approach addresses the experimental design principle of using complementary methods to increase confidence in results and minimize biases that might arise from any single technique .

How should I analyze and interpret ubiquitination assay data for ATL40?

Analyzing and interpreting ubiquitination assay data for ATL40 requires systematic approaches to ensure reliability and biological relevance:

  • Quantitative analysis of western blot data:

    • Use appropriate controls: negative control (reaction without E3 ligase), positive control (known E3-substrate pair)

    • Perform densitometry analysis using software like ImageJ to quantify ubiquitination signals

    • Present data as fold change relative to controls with statistical analysis (t-test or ANOVA)

    • Include time course experiments to determine reaction kinetics

  • Statistical considerations:

    • Perform at least three biological replicates to enable statistical analysis

    • Use appropriate statistical tests (parametric or non-parametric depending on data distribution)

    • Report p-values and confidence intervals

    • Consider power analysis to determine appropriate sample sizes

  • E2 enzyme specificity analysis:

    • Test multiple E2 enzymes to determine specificity using the following table format:

E2 EnzymeRelative Activity with ATL40 (%)Statistical Significance
UBC1value ± SDp-value
UBC2value ± SDp-value
UBC3value ± SDp-value
  • Interpretation guidelines:

    • Distinguish between mono- and polyubiquitination (look for ladder patterns vs. single bands)

    • Consider the type of ubiquitin linkage (K48, K63, etc.) which determines substrate fate

    • Correlate in vitro findings with in vivo observations when possible

    • Acknowledge limitations of in vitro systems compared to cellular environments

  • Mass spectrometry data analysis:

    • Identify ubiquitination sites using specific search parameters

    • Verify spectral matches manually

    • Consider ubiquitination motifs and structural context of modified lysines

This methodological framework helps ensure reliable and reproducible analysis of ubiquitination data while minimizing common biases in interpretation .

What approaches should I use to analyze the evolutionary relationships between ATL40 and other ATL family members?

Analyzing the evolutionary relationships between ATL40 and other ATL family members requires comprehensive phylogenetic and comparative genomic approaches:

  • Sequence acquisition and alignment:

    • Retrieve complete sequences of all 80 ATL family members from Arabidopsis thaliana

    • Include ATL homologs from other plant species, particularly the 121 members identified in Oryza sativa

    • Use multiple sequence alignment tools (MUSCLE, MAFFT, T-Coffee) and compare results

    • Consider structure-guided alignments focusing on conserved domains

  • Phylogenetic analysis:

    • Employ multiple tree-building methods (Maximum Likelihood, Bayesian Inference, Neighbor-Joining)

    • Test different evolutionary models and select the best-fit model based on likelihood tests

    • Assess node support through bootstrap analysis (>1000 replicates) or posterior probabilities

    • Root trees appropriately using outgroups (non-ATL RING proteins)

  • Domain architecture analysis:

    • Map conserved domains (RING-H2 finger, transmembrane domains)

    • Identify lineage-specific domains or motifs

    • Create a domain organization table like the one below:

ATL MemberRING-H2 Domain PositionTM Domain PositionAdditional DomainsSequence Identity to ATL40 (%)
ATL40positionspositionsnames100
ATL8positionspositionsnamesvalue
ATL43positionspositionsnamesvalue
  • Synteny and gene duplication analysis:

    • Examine chromosomal locations and gene order

    • Identify tandem and segmental duplications

    • Calculate Ka/Ks ratios to determine selective pressure

  • Interpretation framework:

    • Group ATL40 with its closest relatives to form subfamilies

    • Correlate phylogenetic relationships with functional data when available

    • Consider the ~60% clustering observed between rice and Arabidopsis ATLs as a benchmark for ortholog identification

    • Examine if ATL40 has potential orthologs in rice with sequence similarities beyond conserved features

This systematic approach provides a robust framework for evolutionary analysis of ATL40 while addressing potential biases in phylogenetic reconstruction methods.

How does ATL40 compare functionally to other characterized members of the ATL family?

While specific functional data for ATL40 is not detailed in the provided search results, we can develop a comparative framework based on known functions of other ATL family members:

  • Functional diversity within the ATL family:

    • ATL43 has been implicated in abscisic acid (ABA) response pathways, as evidenced by ABA-insensitive phenotypes in T-DNA insertion mutants

    • ATL8 appears to play a role during embryogenesis, suggested by its expression pattern in young siliques

    • Other ATL members may be involved in various developmental processes and stress responses

  • Comparative functional analysis framework:

    • Expression pattern comparison across tissues and conditions

    • Phenotypic analysis of loss-of-function mutants

    • Substrate specificity differences

    • Hormone and stress response profiles

  • Predicted functional relationships:

ATL MemberKnown/Predicted FunctionPhenotype of MutantExpression PatternPotential Relationship to ATL40
ATL8EmbryogenesisPotential lethalityYoung siliquesMight share developmental roles
ATL43ABA responseABA-insensitiveUnknownPotential stress response overlap
ATL40To be determinedUnknownUnknown-
  • Functional redundancy considerations:

    • Closely related ATL members may have overlapping functions, requiring multiple gene knockouts to observe phenotypes

    • Sequence similarity alone is insufficient to predict functional equivalence

    • Expression patterns and subcellular localization provide additional clues to functional relationships

  • Research strategy for ATL40 functional characterization:

    • Begin with phylogenetic analysis to identify the closest relatives of ATL40

    • Generate expression profiles under conditions where related ATLs show regulation

    • Create both single and higher-order mutants with related ATLs to address redundancy

    • Consider identifying and comparing substrates between ATL40 and its closest relatives

This comparative framework provides a foundation for understanding ATL40 function in the context of the broader ATL family, while acknowledging the limitations of predictions based on sequence similarity alone.

What roles might ATL40 play in plant stress responses and development?

Based on knowledge of the ATL family and ubiquitin ligase functions in plants, we can hypothesize potential roles for ATL40 in stress responses and development:

  • Potential roles in abiotic stress responses:

    • Some ATL family members respond to environmental stresses, as seen with other plant genes like AtS40-3 which is regulated by dark treatment and ABA

    • ATL40 might participate in protein quality control during stress, targeting damaged or misfolded proteins for degradation

    • E3 ubiquitin ligases often regulate the abundance of stress response factors, suggesting ATL40 may modulate levels of stress-responsive transcription factors or signaling components

  • Possible functions in biotic stress responses:

    • ATL family members may respond to pathogen attack, similar to AtS40-3

    • ATL40 could target defense-related proteins for degradation to fine-tune immune responses

    • Potential roles in hormone-mediated defense pathways (salicylic acid, jasmonic acid)

  • Developmental regulation possibilities:

    • E3 ligases often target developmental regulators, suggesting ATL40 may influence growth and development

    • If ATL40 is essential (like some ATL family members), it may have fundamental roles in cell division or differentiation

    • Potential involvement in developmental transitions or tissue-specific processes

  • Experimental approaches to verify these hypotheses:

    • Expose ATL40 mutants to various stresses and monitor phenotypic differences

    • Perform transcriptome analysis of mutants under normal and stress conditions

    • Identify ATL40 substrates and correlate with known stress response or developmental pathways

    • Characterize spatiotemporal expression patterns during development and stress

  • Methodological considerations:

    • Use multiple alleles or complementation tests to verify phenotypes

    • Consider redundancy with other ATL members through double or triple mutants

    • Implement tissue-specific or inducible expression systems to overcome potential lethality

This systematic exploration of potential ATL40 functions provides testable hypotheses while maintaining scientific rigor in experimental design and interpretation.

What are the key considerations for designing experiments to study protein-protein interactions involving ATL40?

Designing experiments to study protein-protein interactions (PPIs) involving ATL40 requires careful consideration of its unique properties as a RING-H2 finger protein with a transmembrane domain:

  • Construct design considerations:

    • Full-length vs. domain-specific constructs (the transmembrane domain may complicate some assays)

    • Tag position (N- or C-terminal) can affect folding and interactions

    • Consider the potential impact of fusion tags on RING-H2 domain function

    • Include proper controls (inactive RING-H2 mutants) to distinguish specific from non-specific interactions

  • Recommended methodological approaches:

MethodAdvantagesLimitationsSpecial Considerations for ATL40
Yeast Two-Hybrid (Y2H)High-throughput screeningMay miss membrane protein interactionsUse soluble domains; consider split-ubiquitin Y2H for full-length
Co-immunoprecipitationDetects interactions in near-native contextRequires good antibodies or tagsUse mild detergents to solubilize membrane-associated ATL40
Pull-down assaysControls for direct interactionsIn vitro conditions may not reflect in vivoInclude zinc in buffers for RING domain stability
BiFC/FRETVisualizes interactions in living cellsPotential for false positivesVerify that fluorescent tags don't disrupt membrane localization
Proximity labeling (BioID)Detects transient/weak interactionsMay label proximal but non-interacting proteinsGood for membrane proteins; controls crucial
  • Experimental design principles:

    • Include both positive and negative controls in every experiment

    • Test interactions in multiple systems/methods

    • Consider the dynamic nature of E3-substrate interactions (often transient)

    • Account for potential post-translational modifications affecting interactions

    • Design experiments to distinguish E3-E2 from E3-substrate interactions

  • Data analysis and interpretation:

    • Establish clear thresholds for defining positive interactions

    • Implement appropriate statistical analysis for replicate experiments

    • Consider the biological context of identified interactions

    • Validate key interactions with multiple independent methods

This framework addresses the unique challenges of studying PPIs for membrane-associated E3 ubiquitin ligases like ATL40, while maintaining experimental rigor through complementary approaches .

How can I optimize genetic transformation protocols specifically for ATL40 studies in Arabidopsis?

Optimizing genetic transformation protocols for ATL40 studies in Arabidopsis requires attention to construct design, selection strategies, and validation approaches:

  • Vector and construct optimization:

    • For overexpression: Consider using the native promoter or tissue-specific promoters rather than strong constitutive promoters, as constitutive overexpression of E3 ligases may cause pleiotropic effects

    • For complementation: Include the native promoter and 3' UTR regions to maintain natural expression patterns

    • For localization studies: Ensure fluorescent protein fusions don't disrupt the transmembrane domain or RING-H2 finger function

    • For inducible expression: Consider estradiol or dexamethasone-inducible systems for temporal control

  • Transformation protocol considerations:

    • Floral dip method is standard for Arabidopsis, but efficiency can be improved:

      • Use plants at optimal flowering stage (first bolts clipped to encourage secondary inflorescences)

      • Optimize Agrobacterium strain (GV3101 or C58C1 generally work well)

      • Include surfactant (Silwet L-77) at 0.02-0.05%

      • Consider vacuum infiltration for increased efficiency

  • Selection and screening strategies:

    • Use appropriate selection markers (hygromycin, kanamycin, BASTA)

    • Consider fluorescent markers for visual screening

    • For CRISPR/Cas9 edits of ATL40, design screening primers carefully around expected edit sites

  • Validation of transformants:

    • PCR verification of transgene integration

    • RT-PCR and qRT-PCR to confirm expression levels

    • Western blotting to verify protein expression (with appropriate antibodies or tags)

    • Functional complementation testing in atl40 mutant backgrounds

  • Special considerations for ATL40:

    • If ATL40 proves essential for viability (like some ATL family members ), use inducible or tissue-specific systems

    • For structure-function studies, create a panel of ATL40 variants with mutations in key residues

    • Consider co-expression with potential substrate proteins for interaction studies

This methodological framework addresses both general transformation optimization and specific considerations for ATL40 as a RING-H2 finger protein, ensuring reliable and interpretable results in functional studies.

How does ATL40 compare to its orthologs in other plant species?

A comparative analysis of ATL40 with its orthologs in other plant species provides evolutionary insights and functional predictions:

  • Identification of potential orthologs:

    • The ATL family has 80 members in Arabidopsis thaliana and 121 in Oryza sativa (rice)

    • About 60% of rice ATLs cluster with Arabidopsis ATLs, suggesting orthologous relationships

    • True orthologs often show sequence similarities beyond the conserved ATL features (RING-H2 domain, transmembrane domain)

  • Comparative sequence analysis:

    • Sequence conservation patterns (particularly in functional domains)

    • Species-specific adaptations or innovations

    • Synteny analysis to confirm orthologous relationships

  • Ortholog expression pattern comparison:

    • Conservation or divergence of expression patterns across species

    • Tissue-specific or stress-responsive expression similarities

  • Example comparative data table:

SpeciesOrtholog IDSequence Identity (%)Domain ConservationExpression Pattern SimilarityKnown Functions
Arabidopsis thalianaATL40100ReferenceReferenceUnknown
Oryza sativaOsXXXValueDetailsDetailsDetails
Brassica napusBnXXXValueDetailsDetailsDetails
Medicago truncatulaMtXXXValueDetailsDetailsDetails
  • Functional implications and research directions:

    • Conservation across distant species suggests fundamental functions

    • Species-specific divergence might indicate adaptation to different environmental conditions

    • Functional studies in other species could inform ATL40 roles in Arabidopsis

    • Consider cross-species complementation experiments to test functional conservation

This comparative approach leverages evolutionary relationships to generate hypotheses about ATL40 function while providing context for interpreting experimental results across species. The observation that many ATLs show sequence similarities beyond conserved features suggests that orthologous relationships could provide valuable functional insights .

What are the most promising future research directions for understanding ATL40 function?

Based on current knowledge of the ATL family and ubiquitin ligases in plants, several promising research directions emerge for elucidating ATL40 function:

  • Systematic phenotypic characterization:

    • Generate and characterize multiple allelic variants of ATL40 (T-DNA insertions, CRISPR/Cas9 edits)

    • Create higher-order mutants with closely related ATL genes to address functional redundancy

    • Perform detailed phenotypic analysis under various environmental conditions and stresses

    • Develop inducible knockout systems if ATL40 proves essential, as seen with some ATL family members

  • Substrate identification and validation:

    • Implement proximity-dependent labeling approaches (BioID, TurboID) for in vivo substrate identification

    • Perform quantitative proteomics comparing wild-type and atl40 mutants to identify accumulated proteins

    • Validate direct ubiquitination of candidate substrates in vitro and in vivo

    • Map the substrate recognition determinants within ATL40

  • Regulatory network integration:

    • Characterize the transcriptional regulation of ATL40 under various conditions

    • Identify transcription factors controlling ATL40 expression

    • Determine if ATL40 itself regulates transcription factors or signaling components

    • Map the position of ATL40 in known signaling pathways (hormone, stress, development)

  • Structural biology approaches:

    • Determine the three-dimensional structure of ATL40 domains, particularly the RING-H2 finger

    • Investigate structural aspects of substrate recognition

    • Perform structure-guided mutagenesis to correlate structure with function

  • Translational research potential:

    • Explore whether ATL40 function could be harnessed for improving stress tolerance

    • Investigate conservation in crop species and potential for agricultural applications

    • Consider the development of chemical modulators of ATL40 activity for research tools

These research directions would provide complementary insights into ATL40 function while addressing the current gaps in our understanding of this protein's role in plant biology. The approach aligns with best practices in experimental design by combining genetic, biochemical, structural, and systems biology approaches to build a comprehensive functional model .

What methods can be used to study the effects of post-translational modifications on ATL40 function?

Studying post-translational modifications (PTMs) of ATL40 requires specialized approaches to identify modifications and determine their functional consequences:

  • Identification of PTMs on ATL40:

    • Mass spectrometry-based proteomics: Use immunoprecipitation of tagged ATL40 followed by LC-MS/MS analysis

    • Targeted approaches: Western blotting with modification-specific antibodies (phospho-, ubiquitin-, SUMO-specific)

    • In vitro modification assays: Test if ATL40 is a substrate for known kinases, E3 ligases, or other modifying enzymes

  • Functional analysis of identified PTMs:

    • Site-directed mutagenesis: Create non-modifiable variants (e.g., S→A for phosphorylation, K→R for ubiquitination)

    • Phosphomimetic mutations: S→D or S→E to mimic constitutive phosphorylation

    • In vivo complementation: Test if modified/non-modifiable variants can rescue mutant phenotypes

  • Regulatory dynamics of PTMs:

    • Quantitative proteomics to monitor PTM changes under different conditions

    • Time-course analysis following stimulus application

    • Inhibitor studies to block specific modification pathways

  • Biochemical consequences of PTMs:

    • Effect on protein stability (cycloheximide chase assays)

    • Alterations in substrate binding or specificity

    • Changes in subcellular localization

    • Impact on E3 ligase activity

  • Methodological table for PTM analysis:

PTM TypeDetection MethodFunctional Analysis ApproachPotential Biological Significance
PhosphorylationPhospho-proteomics, Phos-tag gelsKinase assays, Phosphomimetic mutationsActivity regulation, Localization
UbiquitinationUbiquitin remnant profilingK→R mutations, DUB treatmentAuto-regulation, Turnover
SUMOylationSUMO-IP, Anti-SUMO WesternK→R mutations, SUMO protease treatmentActivity modulation, Interactions
Redox modificationsRedox proteomics, BIAM labelingC→S mutations, Redox treatmentStress responses, Activity regulation
  • Integration of PTM data:

    • Map modifications onto structural models

    • Identify PTM crosstalk (e.g., phosphorylation affecting ubiquitination)

    • Develop a dynamic model of how PTMs regulate ATL40 function in different contexts

This comprehensive approach to studying PTMs on ATL40 combines discovery-oriented methods with hypothesis-driven functional analyses, providing insights into the complex regulation of this E3 ubiquitin ligase within plant cells.

How can I troubleshoot common problems in ATL40 expression and purification?

Troubleshooting ATL40 expression and purification requires systematic approaches to address challenges commonly encountered with RING-H2 finger proteins and membrane-associated proteins:

  • Poor expression levels:

    • Optimize codon usage for expression system

    • Test multiple expression strains (BL21, Rosetta, Arctic Express for E. coli)

    • Consider fusion partners that enhance solubility (MBP, SUMO, TrxA)

    • Test expression at lower temperatures (16-20°C)

    • For eukaryotic expression, optimize promoter strength and culture conditions

  • Protein insolubility:

    • Remove transmembrane domain for cytoplasmic expression

    • Test detergents for membrane protein solubilization:

DetergentConcentration RangeNotes for ATL40
DDM0.03-0.1%Mild, good for membrane proteins
CHAPS0.5-1%Zwitterionic, preserves protein activity
Triton X-1000.1-1%Effective but can interfere with some assays
Digitonin0.1-1%Gentle solubilization, maintains complexes
  • Proteolytic degradation:

    • Add protease inhibitors throughout purification

    • Include EDTA (except when binding to IMAC columns)

    • Minimize processing time and maintain cold temperature

    • Consider testing multiple constructs with different domain boundaries

  • Low protein activity:

    • Ensure inclusion of zinc (50-100 μM) for RING-H2A domain folding

    • Include reducing agents (DTT or TCEP) to prevent cysteine oxidation

    • Test multiple buffer conditions (pH, salt concentration)

    • Consider protein tags may interfere with activity - test with and without tag cleavage

  • Methodological decision tree:

    • Start with soluble domain expression → If unsuccessful →

    • Try fusion partners → If unsuccessful →

    • Move to eukaryotic expression systems → If unsuccessful →

    • Consider membrane protein expression and purification strategies → If unsuccessful →

    • Cell-free expression systems with detergent micelles or nanodiscs

This troubleshooting framework addresses challenges specific to ATL40 as a RING-H2 finger protein with a transmembrane domain while providing systematic approaches to optimize expression and purification conditions.

What are the best approaches for studying ATL40 in its native cellular context?

Studying ATL40 in its native cellular context requires methods that preserve physiological conditions while enabling detailed analysis:

  • Endogenous tagging strategies:

    • CRISPR/Cas9-mediated knock-in of small epitope tags or fluorescent proteins

    • Consider the impact of tag position (N- vs. C-terminal) on protein function

    • Verify that tagged versions retain wild-type function through complementation tests

    • Implement inducible degradation systems (AID, dTAG) for temporal control of protein levels

  • Advanced microscopy approaches:

    • Super-resolution microscopy (PALM/STORM, SIM) for detailed localization

    • FRET/FLIM for protein-protein interactions in live cells

    • Photoactivatable or photoconvertible fluorescent proteins for protein dynamics

    • Single-molecule tracking to analyze ATL40 mobility and interactions

  • In situ protein analysis:

    • Proximity labeling (BioID, TurboID, APEX) to identify interacting proteins

    • FACS-based approaches for cell-type-specific analysis

    • Conditional splicing systems to study domain-specific functions

    • Single-cell proteomics to address cellular heterogeneity

  • Native complex isolation:

    • Blue native PAGE to preserve protein complexes

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Size exclusion chromatography coupled to mass spectrometry (SEC-MS)

    • Co-immunoprecipitation under native conditions

  • Tissue and cell-type specific approaches:

    • Cell type-specific promoters for targeted expression

    • INTACT method for nuclei isolation from specific cell types

    • Laser capture microdissection for tissue-specific analysis

    • Single-cell transcriptomics to correlate with protein studies

These approaches maintain the biological context of ATL40 function while enabling detailed molecular analysis, addressing the experimental design principle of balancing physiological relevance with analytical precision . Combining multiple complementary methods provides the most comprehensive understanding of ATL40 in its native environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.