Recombinant Arabidopsis thaliana RING-H2 finger protein ATL43 (ATL43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL43; At5g05810; MJJ3.23; RING-H2 finger protein ATL43; RING-type E3 ubiquitin transferase ATL43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-407
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL43
Target Protein Sequence
DNHTAVVITTSDTPPPLPPPSPPPRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHC KRRNGSVYVNHPQRFAITRYGGGYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKD GLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDC NSWFELQFSKDESNSVNNNPPGLTRFIPVSRISGRHSSAGERASRLNEIRTSSSYKSNPM SFRRSLDSSLKVNDAGEEKSESVAVNCLDRLQRKDGLLLIPNRESFEGRFEHRIIISGGN RDDQRWSEVRPSDLLYLRSEMILSDCRKLAAAEGGRDVINGRSVSELTGIERRRRWGGEP RQRQATAVISRWLAWSHRASASSIV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G05810

STRING: 3702.AT5G05810.1

UniGene: At.50435

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL43 and to which protein family does it belong?

ATL43 is a member of the Arabidopsis Toxicos en Levadura (ATL) gene family, which encodes RING-H2 finger domain proteins in Arabidopsis thaliana. It belongs to a larger class of ubiquitin ligases that function in the ubiquitin/26S proteasome pathway, which is responsible for protein degradation in eukaryotes. The ATL family has approximately 80 members in A. thaliana and 121 in Oryza sativa (rice) . ATL proteins contain a distinctive RING-H2 finger domain that coordinates zinc ligation with specific spacing between ligands, and typically feature a transmembrane domain at the N-terminus .

What is the general structure of ATL43?

Like other members of the ATL family, ATL43 possesses:

  • A transmembrane domain toward the N-terminus

  • A conserved GLD motif (12-16 amino acids that often begin with glycine, leucine, and aspartic acid residues) located between the transmembrane domain and the RING-H2 domain

  • A characteristic RING-H2 finger domain that contains six cysteines and two histidines that coordinate zinc ligation

  • A conserved tryptophan residue spaced three residues downstream from the sixth zinc ligand

The RING-H2 domain also contains other conserved amino acid residues beyond the canonical zinc ligands, including a leucine following the second metal ligand, a phenylalanine preceding the fifth ligand, and a proline next to the seventh ligand .

What is the genetic organization of ATL43?

Like approximately 90% of ATL genes, ATL43 is likely an intronless gene. This intronless structure is common across the ATL family and suggests that the structure of the basic ATL protein may have evolved as a functional module . The absence of introns may facilitate rapid expression in response to environmental stresses, as no splicing is required during transcription.

What is the primary function of ATL43 in plants?

ATL43 functions as an E3 ubiquitin ligase that participates in substrate specification and mediates the transfer of ubiquitin to target proteins within the ubiquitin/26S proteasome pathway . Specifically, research involving T-DNA insertion has revealed that ATL43 has a role in the abscisic acid (ABA) response pathway . Plants with a T-DNA insertion in ATL43 showed an ABA-insensitive phenotype, indicating that this gene is involved in ABA-mediated signaling processes that regulate various aspects of plant growth, development, and stress responses .

How does ATL43 relate to plant hormone responses?

A T-DNA insertion line in ATL43 exhibited an ABA-insensitive phenotype, strongly suggesting that ATL43 plays a significant role in mediating responses to the plant hormone abscisic acid (ABA) . ABA is a critical phytohormone involved in multiple physiological processes including:

  • Seed dormancy and germination

  • Stomatal closure

  • Responses to various environmental stresses, particularly drought stress

  • Root growth and development

Through its E3 ubiquitin ligase activity, ATL43 likely targets specific proteins in the ABA signaling pathway for ubiquitination and subsequent degradation, thus regulating their abundance and activity in response to environmental cues .

What protein interactions are known for ATL43?

While the search results don't specifically detail the protein interactions of ATL43, the structure and function of ATL proteins suggest potential interaction regions. The RING-H2 domain typically mediates interactions with E2 ubiquitin-conjugating enzymes, while other regions of the protein are likely involved in substrate recognition. Yeast two-hybrid assays have been used to identify potential regions in ATLs that mediate protein-protein interactions . To fully characterize ATL43's interactome, techniques such as co-immunoprecipitation, pull-down assays, or proximity-dependent biotin identification (BioID) would be appropriate methodological approaches.

What methods are most effective for studying ATL43 expression patterns?

For studying ATL43 expression patterns, researchers should consider multiple complementary approaches:

  • Quantitative RT-PCR: For quantifying ATL43 transcript levels across different tissues, developmental stages, or in response to various treatments.

  • Promoter-Reporter Fusions: Creating transgenic plants with the ATL43 promoter fused to reporter genes like GUS or fluorescent proteins can visualize spatial and temporal expression patterns.

  • RNA-Seq Analysis: For genome-wide transcriptome studies that can place ATL43 expression in the context of global gene expression networks. Databases such as TOAST (Test Of Arabidopsis Space Transcriptome) can be valuable for comparing ATL43 expression across multiple experimental conditions .

  • In situ Hybridization: For high-resolution localization of ATL43 mRNA in specific tissues.

  • Immunolocalization: Using ATL43-specific antibodies to detect the protein in plant tissues, providing information about protein localization that may differ from transcript localization.

What are the best approaches for generating and validating ATL43 mutants?

Several approaches can be employed to generate and validate ATL43 mutants:

  • T-DNA Insertion Lines: Previous research has successfully used T-DNA insertions to study ATL43 function, resulting in the identification of an ABA-insensitive phenotype . T-DNA insertion collections are available through stock centers.

  • CRISPR/Cas9 Gene Editing: For creating precise mutations or knockouts in the ATL43 gene.

  • RNAi or Artificial microRNA: To achieve knockdown of ATL43 expression, which may be useful if complete knockout is lethal.

  • Overexpression Lines: Creating transgenic plants that overexpress ATL43 under constitutive or inducible promoters to assess gain-of-function phenotypes.

For validation, researchers should:

  • Confirm the mutation by PCR and sequencing

  • Verify altered expression levels using qRT-PCR

  • Perform complementation tests by introducing the wild-type gene into the mutant background

  • Analyze protein levels using western blotting with ATL43-specific antibodies

How can the ubiquitin ligase activity of ATL43 be assessed in vitro and in vivo?

In vitro assessment methods:

  • Autoubiquitination Assays: Recombinant ATL43 protein can be incubated with E1, E2 enzymes, ubiquitin, and ATP to detect self-ubiquitination activity by western blotting.

  • Substrate Ubiquitination Assays: Once potential substrates are identified, in vitro ubiquitination assays can be performed with purified components to demonstrate direct ubiquitination.

  • E2 Enzyme Binding Assays: Yeast two-hybrid or pull-down assays to identify which E2 ubiquitin-conjugating enzymes interact with ATL43.

In vivo assessment methods:

  • Co-immunoprecipitation: To detect ubiquitinated substrates in plant cells expressing tagged versions of ATL43.

  • Cell-free Degradation Assays: Using plant extracts to monitor the degradation of potential substrates in the presence or absence of functional ATL43.

  • Ubiquitin Remnant Profiling: Proteomics approach to identify ubiquitinated lysine residues on proteins that are differentially modified in ATL43 mutants versus wild-type plants.

  • Cycloheximide Chase Assays: To monitor the stability of potential substrate proteins in wild-type versus ATL43 mutant backgrounds.

How does ATL43 contribute to ABA-mediated stress responses?

The T-DNA insertion in ATL43 that results in an ABA-insensitive phenotype strongly suggests that ATL43 functions as a positive regulator in the ABA signaling pathway . ABA is a critical hormone for plant responses to various abiotic stresses, particularly drought, high salinity, and cold.

ATL43 likely contributes to ABA-mediated stress responses through the following mechanisms:

  • Protein Degradation Control: As an E3 ubiquitin ligase, ATL43 may target negative regulators of ABA signaling for degradation, thereby enhancing ABA responses.

  • Signaling Cascade Regulation: ATL43 may regulate the abundance or activity of transcription factors or other signaling components involved in ABA-responsive gene expression.

  • Stomatal Regulation: Given ABA's role in stomatal closure, ATL43 may influence water loss and drought tolerance by affecting guard cell responses to ABA.

To fully characterize ATL43's role in stress responses, researchers should compare wild-type and atl43 mutant plants under various stress conditions while monitoring physiological parameters (water loss, electrolyte leakage, ROS accumulation) and molecular markers of stress responses.

What is known about the transcriptional regulation of ATL43 under stress conditions?

While the search results don't provide specific information about ATL43 transcriptional regulation under stress, several approaches can be used to investigate this:

  • Promoter Analysis: In silico analysis of the ATL43 promoter region can identify potential binding sites for stress-responsive transcription factors.

  • Expression Profiling: Using qRT-PCR or RNA-Seq to monitor ATL43 expression under various stress conditions and hormone treatments.

  • Chromatin Immunoprecipitation (ChIP): To identify transcription factors that bind to the ATL43 promoter.

  • Promoter Deletion Analysis: Creating transgenic plants with different lengths of the ATL43 promoter fused to reporter genes to identify regions critical for stress-responsive expression.

The TOAST database mentioned in search result could be utilized to examine ATL43 expression patterns across various stress conditions, particularly spaceflight-related stresses that may involve ABA signaling pathways.

How does the structure of ATL43 compare to other ATL family members?

ATL43 belongs to the broader ATL family that contains approximately 80 members in Arabidopsis thaliana . Comparative structural analysis would involve:

  • Domain Architecture Comparison: While all ATLs share the RING-H2 domain and typically have a transmembrane domain, variations in other regions and motifs might confer functional specificity to ATL43.

  • RING-H2 Domain Alignment: The specific residues within the RING-H2 domain of ATL43 could be compared to other ATLs to identify unique features beyond the conserved zinc-coordinating residues.

  • GLD Motif Analysis: Comparison of the GLD motif in ATL43 with other family members might reveal specific features that contribute to its role in ABA signaling.

  • Phylogenetic Analysis: Constructing a phylogenetic tree of ATL proteins to determine which subgroup ATL43 belongs to and which members are most closely related, potentially sharing similar functions.

Using the 75 PSPM (position-specific probability matrix) LOGOs generated for the ATL family , researchers could determine which of the 9 classified groups ATL43 belongs to, providing insight into its evolutionary history and potential functional relationships.

What are the potential downstream targets of ATL43 ubiquitination in the ABA signaling pathway?

Identifying the substrates of ATL43 ubiquitination is critical for understanding its specific role in ABA signaling. Potential approaches include:

  • Yeast Two-Hybrid Screening: To identify proteins that interact with ATL43, excluding the transmembrane domain that might interfere with nuclear localization required for Y2H assays.

  • Immunoprecipitation coupled with Mass Spectrometry: Using tagged versions of ATL43 to pull down interacting proteins, particularly focusing on proteins that accumulate in atl43 mutants.

  • Comparative Proteomics: Analyzing differences in protein abundance and ubiquitination patterns between wild-type and atl43 mutant plants, especially after ABA treatment.

Potential candidates for ATL43 ubiquitination targets might include:

  • ABA receptors (PYR/PYL/RCAR family)

  • Protein phosphatases (PP2Cs) that negatively regulate ABA signaling

  • SnRK2 protein kinases

  • Transcription factors involved in ABA-responsive gene expression (such as ABFs/AREBs)

  • Ion channels or transporters involved in guard cell responses to ABA

How do post-translational modifications affect ATL43 function?

While specific information about post-translational modifications (PTMs) of ATL43 is not provided in the search results, E3 ubiquitin ligases are often subject to various PTMs that regulate their activity, localization, and stability. Potential research questions include:

  • Phosphorylation: Is ATL43 phosphorylated in response to ABA or stress conditions? Which kinases are responsible, and how does phosphorylation affect its activity?

  • Self-ubiquitination: Many RING-type E3 ligases can self-ubiquitinate. Does ATL43 regulate its own turnover through self-ubiquitination, and how does this impact ABA signaling?

  • S-nitrosylation or oxidation: Given the role of reactive oxygen and nitrogen species in stress responses, are the cysteine residues in the RING-H2 domain of ATL43 subject to redox-based modifications?

  • Membrane association dynamics: How stable is ATL43's association with membranes, and can it be regulated by post-translational modifications?

Research methodologies to address these questions would include:

  • Phosphoproteomic analysis of ATL43 under various conditions

  • Mutagenesis of potential modification sites followed by functional assays

  • In vitro biochemical assays with modified versus unmodified proteins

  • Subcellular localization studies under different conditions

How conserved is ATL43 across different plant species?

Based on the information in search result , approximately 60% of rice ATLs are clustered with A. thaliana ATLs, and in many cases, the gene products showed sequence similarities beyond the conserved features of ATLs, suggesting they could be orthologous genes. To analyze ATL43 conservation specifically:

  • Ortholog Identification: Using tools like BLAST, OrthoFinder, or phylogenetic analyses to identify potential ATL43 orthologs in other plant species.

  • Domain Conservation Analysis: Comparing the conservation of different domains (transmembrane, GLD motif, RING-H2) across species.

  • Synteny Analysis: Examining whether ATL43 orthologs are found in syntenic regions across related plant genomes, which would support orthology.

  • Expression Pattern Comparison: Determining if ATL43 orthologs show similar expression patterns in response to ABA or stress conditions across species.

This evolutionary analysis could provide insight into when the specific function of ATL43 in ABA signaling emerged during plant evolution and how conserved this role is across land plants.

What can we learn from comparing ATL43 with other ABA-responsive E3 ligases?

Several other E3 ubiquitin ligases have been implicated in ABA signaling, including RGLG1/2, CRL4, and AIP2. Comparing ATL43 with these E3 ligases could reveal:

  • Mechanistic Diversity: Whether different E3 ligases target distinct components of the ABA signaling pathway.

  • Regulatory Patterns: If there are differences in how these E3 ligases are themselves regulated by ABA or stress conditions.

  • Functional Redundancy: The extent to which different E3 ligases might compensate for each other's loss.

  • Evolutionary Relationships: Whether these ABA-responsive E3 ligases evolved independently to regulate ABA signaling or share a common ancestry.

Experimental approaches would include generating and characterizing multiple mutants, comparative expression analyses, and detailed biochemical characterization of substrate specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.