Recombinant Arabidopsis thaliana RING-H2 finger protein ATL44 (ATL44)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL44 (ATL44) is a member of the ATL family of proteins in Arabidopsis thaliana . The ATL family is characterized by the presence of a RING-H2 finger domain, which functions as an E3 ubiquitin ligase . E3 ubiquitin ligases play a crucial role in the ubiquitin-proteasome pathway, which is responsible for protein degradation in eukaryotic cells .

Identification and Characteristics of ATL44

The Arabidopsis thaliana genome contains a large number of genes encoding ubiquitin ligases, with over 1300 genes predicted to encode these enzymes . Among these, the ATL family comprises a significant portion, with 80 members identified in A. thaliana . ATL44 is one of these members and is also designated as AT2G17450 in the Arabidopsis thaliana genome .

Key features of ATL proteins, including ATL44, are :

  • RING-H2 Domain: A variation of the canonical RING finger domain, characterized by a specific arrangement of cysteine and histidine residues that coordinate zinc ions.

  • Hydrophobic Region: A region rich in hydrophobic amino acids, potentially functioning as a transmembrane domain.

  • GLD Region: A highly conserved region with an unknown function, named after three conserved amino acids within the motif.

Function and Significance

ATL44 is annotated as a probable E3 ubiquitin-protein ligase . E3 ubiquitin ligases confer substrate specificity in the ubiquitination process, facilitating the transfer of ubiquitin to target proteins . Ubiquitination can lead to the degradation of proteins via the 26S proteasome pathway or alter protein function, localization, or interaction .

Although the precise function of ATL44 is not fully elucidated, other members of the ATL family have been shown to be involved in various processes in plants, including :

  • Defense responses

  • Regulation of carbon/nitrogen response during seedling growth

  • Regulation of cell death during root development

  • Endosperm development

  • Transition to flowering

One study suggests that RING-H2 finger protein ATL2 may be involved in the early steps of the plant defense signaling pathway .

Expression and Regulation

The expression patterns of ATL genes can vary, with some being expressed in specific tissues or under certain conditions . For example, ATL8 is mainly expressed in young siliques, suggesting a role during embryogenesis . Additionally, the expression of some ATL genes can be induced by defense-related stimuli, such as chitin . One study showed that induction of AthATL9 expression by chitin was dramatically weakened in Atrboh mutants, demonstrating that expression and induction of AthATL9 depends on NADPH oxidases .

Research and Mutant Studies

Insertional mutagenesis studies using T-DNA insertions have been conducted for some ATL genes to investigate their function . For example, a T-DNA insertion in ATL43 resulted in an ABA-insensitive phenotype, suggesting a role in the ABA response . Analysis of athatl9 mutants demonstrated its involvement in defense responses, with T-DNA insertional mutants in AthATL9 being more susceptible than wild-type to the biotrophic fungus pathogen Golovinomyces cichoracearum .

Availability of Recombinant ATL44

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL44 is available for purchase from some vendors for research purposes . It can be produced in different expression systems, including yeast, E. coli, baculovirus, and mammalian cells .

Table Summarizing Key Information on ATL44

PropertyDescription
Gene NameATL44
Alternative DesignationAT2G17450
Protein TypeRING-H2 finger protein, probable E3 ubiquitin-protein ligase
OrganismArabidopsis thaliana
DomainRING-H2 finger
FunctionPart of the ubiquitin-proteasome pathway, may be involved in plant defense and other developmental processes; E3 ubiquitin ligase
Expression SystemsYeast, E. coli, Baculovirus, Mammalian cell
Related StudiesInsertional mutagenesis, expression analysis, structural studies of RING-H2 domain

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as required.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ATL44; RHA3A; At2g17450; F5J6.22; MJB20; Probable E3 ubiquitin-protein ligase ATL44; RING-H2 finger A3a; RING-H2 finger protein ATL44; RING-H2 zinc finger protein RHA3a; RING-type E3 ubiquitin transferase ATL44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL44
Target Protein Sequence
MTRPSRLLETAAPPPQPSEEMIAAESDMVVILSALLCALICVAGLAAVVRCAWLRRFTAG GDSPSPNKGLKKKALQSLPRSTFTAAESTSGAAAEEGDSTECAICLTDFADGEEIRVLPL CGHSFHVECIDKWLVSRSSCPSCRRILTPVRCDRCGHASTAEMKDQAHRHQHHQHSSTTI PTFLP
Uniprot No.

Target Background

Function

ATL44 is an E3 ubiquitin-protein ligase exhibiting in vitro E3 ubiquitin ligase activity and mediating protein monoubiquitination. It triggers the monoubiquitination of phosphorylated BIK1 in response to the detection of pathogen-associated molecular patterns (PAMPs).

Database Links

KEGG: ath:AT2G17450

STRING: 3702.AT2G17450.1

UniGene: At.25384

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in stems, flowers and green siliques.

Q&A

What is the structure and function of the RING-H2 domain in ATL44?

The RING-H2 finger domain in ATL44 belongs to a class of zinc finger proteins characterized by a C3H2C3 (Cys-X2-Cys-X(9-39)-Cys-X(1-3)-His-X(2-3)-His-X(2)-Cys-X(4-48)-Cys-X2-Cys) amino acid motif that coordinates two zinc ions in a cross-brace structure. This domain is critical for ATL44's E3 ubiquitin ligase activity, facilitating the transfer of ubiquitin from an E2 conjugating enzyme to target substrate proteins . The RING-H2 domain specifically interacts with E2 enzymes through conserved residues that determine substrate specificity and degradation pathways.

How does ATL44 contribute to protein ubiquitination pathways in Arabidopsis?

ATL44 functions as a component of the ubiquitin-proteasome system (UPS), where it:

  • Recognizes specific substrate proteins for ubiquitination

  • Binds to ubiquitin-conjugating E2 enzymes via its RING-H2 domain

  • Facilitates the transfer of ubiquitin to target proteins

  • Potentially regulates protein degradation, localization, or function through mono- or poly-ubiquitination

This process is crucial for various cellular mechanisms, including hormone signaling, developmental regulation, and stress responses in Arabidopsis thaliana .

What expression patterns does ATL44 exhibit across different developmental stages?

ATL44 shows tissue-specific and developmental stage-dependent expression patterns. While comprehensive expression analysis specifically for ATL44 is still developing, studies of related RING-H2 proteins in Arabidopsis suggest dynamic regulation across tissues and developmental stages. Expression may be particularly elevated in actively growing tissues and during specific developmental transitions, similar to other RING family proteins involved in developmental regulation. Gene expression databases and transcriptomic analyses can provide tissue-specific expression patterns that help inform experimental design when studying ATL44 function.

What are the optimal methods for recombinant expression and purification of ATL44?

For successful recombinant expression and purification of ATL44:

Expression System Selection:

  • E. coli BL21(DE3): Suitable for basic structural studies, though may result in inclusion bodies

  • Insect cell systems: Better for preserving enzymatic activity and folding

  • Plant-based expression: Ideal for maintaining native post-translational modifications

Purification Strategy:

  • Use N-terminal or C-terminal affinity tags (His₆, GST, MBP) positioned to avoid interfering with RING-H2 domain

  • Include zinc in purification buffers (typically 10-50 μM ZnCl₂) to maintain RING domain integrity

  • Use reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Consider size exclusion chromatography as a final purification step to ensure homogeneity

  • Verify activity through in vitro ubiquitination assays with appropriate E1 and E2 enzymes

Protein yield and stability can be improved by expressing only the catalytic RING-H2 domain rather than the full-length protein when structural or biochemical studies are the primary goal.

How can I design effective knockout and overexpression lines to study ATL44 function?

For CRISPR/Cas9 Knockout Design:

  • Target conserved regions within the RING-H2 domain for maximum disruption of function

  • Design at least 3-4 guide RNAs targeting different exons to increase efficiency

  • Confirm mutations by sequencing and verify protein absence via Western blot

  • Screen for off-target effects by whole-genome sequencing of selected lines

For Overexpression Studies:

  • Use the strong constitutive 35S promoter for general overexpression or tissue-specific promoters for targeted studies

  • Include epitope tags (HA, FLAG, GFP) for protein detection and localization

  • Create both N- and C-terminal fusion constructs to account for potential functional interference

  • Generate inducible overexpression lines using systems like estradiol-inducible or dexamethasone-inducible promoters to control expression timing

Phenotypic Analysis:

  • Compare multiple independent transgenic lines to account for positional effects

  • Analyze at least 3 generations to ensure stable phenotypes

  • Include complementation studies to confirm phenotype specificity

What are the most reliable methods for detecting protein-protein interactions involving ATL44?

MethodAdvantagesLimitationsBest Application
Yeast Two-Hybrid (Y2H)High-throughput screening capability; Detects direct interactionsHigh false positive rate; Non-plant environmentInitial screening of interaction partners
Co-immunoprecipitation (Co-IP)Detects interactions in plant cells; Can capture complexesRequires suitable antibodies; May include indirect interactionsConfirming interactions in planta
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in living cells; Provides spatial informationIrreversible complex formation; Potential for self-assemblyLocalizing interactions within cell compartments
Pull-down assaysDemonstrates direct physical interaction; QuantifiableRequires purified proteins; Non-physiological conditionsConfirming direct interactions in vitro
Förster Resonance Energy Transfer (FRET)Real-time interaction dynamics; Non-invasiveRequires specialized equipment; Complex optimizationStudying dynamic interactions in living cells

When studying ATL44 interactions, combining at least two complementary approaches is recommended. For E3 ligases like ATL44, transient interaction with substrates can make detection challenging, so consider using proteasome inhibitors (MG132) or catalytically inactive ATL44 mutants (mutations in key RING-H2 domain residues) to stabilize interactions.

How can I identify and validate potential substrate proteins for ATL44?

Identifying substrates for E3 ubiquitin ligases like ATL44 requires multiple complementary approaches:

Identification Strategies:

  • Proximity-dependent labeling: Use BioID or TurboID fusions with ATL44 to biotinylate proteins in close proximity, followed by streptavidin pulldown and mass spectrometry

  • Quantitative proteomics: Compare protein abundance in wild-type vs. atl44 mutants with and without proteasome inhibition

  • Yeast two-hybrid screening: Use ATL44 as bait, but exclude the RING domain or use catalytically inactive variants to stabilize interactions

  • Protein microarrays: Screen plant protein arrays with purified ATL44 to identify direct binding partners

Validation Protocol:

  • Confirm direct interaction using in vitro pull-down assays with purified proteins

  • Demonstrate ubiquitination in vitro using recombinant E1, E2, ATL44, substrate, and ubiquitin

  • Show ubiquitination in planta by co-expressing ATL44 and substrate with tagged ubiquitin

  • Demonstrate altered substrate stability or modification in ATL44 overexpression and knockout lines

  • Perform domain mapping to identify specific interaction interfaces and ubiquitination sites

When presenting substrate identification data, include appropriate controls such as catalytically inactive ATL44 mutants and quantitative measurements of ubiquitination efficiency.

What considerations are important when analyzing the evolutionary conservation of ATL44?

When conducting evolutionary analyses of ATL44:

  • Sequence Selection:

    • Include RING-H2 proteins from diverse plant species, spanning monocots, dicots, and non-flowering plants

    • Incorporate both close homologs and more distant RING-H2 proteins to establish orthology

  • Domain-Specific Analysis:

    • Analyze RING-H2 domain conservation separately from full-length protein

    • Identify conserved residues likely involved in catalysis versus substrate recognition

    • Map conservation onto predicted structural models

  • Synteny Analysis:

    • Examine genomic context to strengthen orthology predictions

    • Identify conserved gene neighbors across species

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across different protein regions to identify domains under purifying or positive selection

    • Use site-specific models to identify individual amino acids under selection

  • Correlation with Function:

    • Compare conservation patterns with experimental data on protein function

    • Identify co-evolution patterns with known interactors or substrates

A robust evolutionary analysis should distinguish between conservation reflecting core enzymatic function versus species-specific adaptations in substrate recognition or regulation.

How does ATL44 expression change under different abiotic stress conditions?

While specific data on ATL44 expression under stress conditions is still emerging, RING-H2 proteins in Arabidopsis frequently show dynamic regulation in response to environmental stresses. Based on studies of related proteins:

Expected Expression Patterns:

  • Drought stress: Potential upregulation to modulate ABA signaling components

  • Salt stress: Possible induction to regulate ion transporters or signaling proteins

  • Temperature stress: May show temperature-dependent expression changes

  • Oxidative stress: Potential role in mediating redox signaling through targeted protein degradation

Methodological Considerations for Expression Analysis:

  • Use multiple time points (early: 0.5-3h; intermediate: 6-12h; late: 24-48h) to capture transient expression changes

  • Include graduated stress intensities to identify threshold responses

  • Combine transcriptomic analysis with protein-level studies, as post-transcriptional regulation is common

  • Consider tissue-specific responses, as stress responses often vary between roots, shoots, and reproductive tissues

  • Include recovery phases to identify potential roles in stress recovery

When designing experiments to study ATL44 in stress responses, include appropriate stress markers as positive controls to verify stress application efficacy.

What regulatory mechanisms control ATL44 activity beyond transcriptional regulation?

ATL44, like other RING-H2 E3 ligases, is likely subject to multiple layers of regulation:

Post-translational Modifications:

  • Phosphorylation may alter substrate recognition, protein interactions, or subcellular localization

  • Self-ubiquitination could regulate protein turnover and activity

  • S-nitrosylation of cysteine residues in the RING domain may modulate catalytic activity

Protein-Protein Interactions:

  • Interaction with adaptor proteins may alter substrate specificity

  • Association with deubiquitinating enzymes could counterbalance ubiquitination activity

  • Formation of higher-order complexes may regulate access to substrates

Spatial Regulation:

  • Membrane association or compartmentalization may restrict access to specific substrate pools

  • Nucleocytoplasmic shuttling could regulate access to nuclear substrates

Metabolic Regulation:

  • Sensitivity to cellular redox state through cysteine residues in the RING domain

  • Potential allosteric regulation by metabolites or signaling molecules

Investigating these regulatory mechanisms requires combining biochemical approaches with cell biology techniques and in vivo studies using reporter fusions and real-time imaging.

How does ATL44 interact with plant hormone signaling pathways?

RING-H2 proteins often play crucial roles in hormone signaling, primarily through targeted degradation of signaling components. While specific interactions of ATL44 are still being characterized, potential roles may include:

Auxin Signaling:

  • Potential regulation of AUX/IAA repressors or ARF transcription factors

  • Possible modulation of auxin transport through regulation of PIN protein stability

Abscisic Acid (ABA) Pathway:

  • May regulate ABA receptors (PYR/PYL/RCAR proteins) or PP2C phosphatases

  • Could influence ABA-responsive transcription factors like ABFs

Jasmonate Signaling:

  • Potential regulation of JAZ repressors to modulate JA responses

  • May influence COI1 complex formation or activity

Strigolactone Pathway:

  • Could interact with components of strigolactone signaling, which affects branching and development

  • May influence degradation of strigolactone signaling components

Experimental Approaches:

  • Analyze hormone sensitivity phenotypes in atl44 mutants and overexpression lines

  • Measure changes in known hormone pathway components in ATL44-modulated plants

  • Investigate direct interactions between ATL44 and hormone signaling proteins

  • Examine changes in ATL44 expression, localization, or activity in response to hormone treatments

Understanding ATL44's role in hormone networks requires systematic analysis across multiple hormone pathways to identify specific points of intersection.

What statistical approaches are appropriate for analyzing phenotypic data from ATL44 mutant studies?

When analyzing phenotypic data from ATL44 studies, consider these statistical approaches based on experimental design:

For Comparing Multiple Genotypes (e.g., WT, atl44, complementation lines):

  • ANOVA followed by post-hoc tests (Tukey's HSD for balanced designs, Scheffé's method for unbalanced designs)

  • Mixed-effects models when incorporating random factors (e.g., experimental blocks)

  • Non-parametric alternatives (Kruskal-Wallis followed by Dunn's test) when normality assumptions are violated

For Time-Course Experiments:

  • Repeated measures ANOVA or mixed models with time as a fixed effect

  • Growth curve analysis using non-linear regression models

  • Consider using area under the curve (AUC) measures for summarizing responses over time

For Complex Phenotypes:

  • Principal Component Analysis (PCA) to reduce dimensionality of multiple phenotypic measurements

  • Multivariate ANOVA (MANOVA) when analyzing correlated phenotypic traits

  • Path analysis to explore relationships between multiple phenotypic variables

Sample Size Considerations:

  • Conduct power analysis before experiments to determine appropriate sample sizes

  • For preliminary studies, aim for at least 15-20 biological replicates per genotype

  • Increase sample sizes when expecting subtle phenotypic differences

Proper statistical analysis should account for biological and technical replicates, with clear distinction between these variance sources in the statistical model.

How can I integrate transcriptomic and proteomic data to better understand ATL44 function?

Integrating multi-omics data provides comprehensive insights into ATL44 function:

Data Integration Framework:

  • Pre-processing Alignment:

    • Ensure consistent identifiers across datasets

    • Apply appropriate normalization methods for each data type

    • Consider batch effects and technical variations

  • Primary Integration Approaches:

    • Correlation networks: Identify correlated changes across transcripts and proteins

    • Pathway enrichment: Apply to both datasets separately, then compare enriched pathways

    • Machine learning: Use supervised methods to identify features predictive of ATL44 function

  • Advanced Integration Strategies:

    • Bayesian network modeling: Infer causal relationships between ATL44, transcripts, and proteins

    • Protein complex enrichment: Overlay expression data onto known protein complexes

    • Integrative clustering: Group genes/proteins with similar patterns across multiple data types

  • Biological Validation:

    • Verify key predictions from integrated analysis using targeted experiments

    • Focus on nodes showing discordant transcript-protein relationships as potential ATL44 substrates

Tools and Resources:

  • NetworkAnalyst for integrated network analysis

  • MixOmics package in R for multivariate integration approaches

  • WGCNA for co-expression network analysis

  • GSEA for pathway enrichment across multiple data types

When reporting integrated analyses, clearly distinguish between correlation-based associations and experimentally validated relationships.

What bioinformatic approaches can help predict potential ubiquitination sites in ATL44 substrate proteins?

Computational prediction of ubiquitination sites combines sequence-based, structural, and machine learning approaches:

Sequence-Based Prediction:

  • Motif analysis: Identify enriched sequence patterns in known substrates

    • Search for degron motifs that may mediate substrate recognition

    • Use motif discovery tools like MEME and GLAM2 on validated substrates

  • Feature-based prediction:

    • UbPred, UbiSite, and UbiProber use protein sequence features to predict ubiquitination sites

    • Consider features like surface accessibility, disorder propensity, and evolutionary conservation

Structure-Based Approaches:

  • Binding site prediction:

    • Use tools like HADDOCK or ClusPro for protein-protein docking between ATL44 and potential substrates

    • Identify potential interaction surfaces through homology modeling

  • Molecular dynamics:

    • Simulate interactions between ATL44 and substrate peptides

    • Evaluate binding energy and stability of potential recognition sites

Machine Learning Integration:

  • Ensemble methods:

    • Combine predictions from multiple algorithms (DeepUbi, ESA-UbiSite)

    • Weight predictions based on algorithm performance for E3 ligase-specific substrates

  • Network-based predictions:

    • Incorporate protein-protein interaction data with sequence/structure predictions

    • Consider functional association networks to enhance prediction accuracy

Validation Strategy:

  • Generate lysine-to-arginine mutants at predicted sites

  • Perform in vitro and in vivo ubiquitination assays with mutated substrates

  • Compare ubiquitination patterns of wild-type and mutant substrates

The most effective approach combines computational predictions with experimental validation in an iterative process.

How can I address solubility issues when working with recombinant ATL44?

Solubility problems are common when expressing RING-H2 proteins like ATL44. Consider these strategies:

Expression Optimization:

  • Temperature reduction: Lower induction temperature to 16-18°C and extend expression time

  • Induction modulation: Reduce IPTG concentration to 0.1-0.2 mM for slower protein accumulation

  • Media enhancement: Add 0.5-1% glucose to suppress basal expression before induction

  • Co-expression strategies: Include chaperones (GroEL/GroES, DnaK/DnaJ) to aid folding

Construct Design:

  • Domain-based approach: Express only the RING-H2 domain rather than full-length protein

  • Solubility tags: Use MBP, SUMO, or TrxA fusion tags instead of simple His-tags

  • Domain boundaries: Test multiple N- and C-terminal boundaries to identify optimal constructs

  • Codon optimization: Optimize codons for expression host, especially for rare codons

Buffer Optimization:

  • Zinc supplementation: Include 10-50 μM ZnCl₂ in all buffers to stabilize the RING domain

  • Reducing agents: Use 5 mM DTT or TCEP to prevent cysteine oxidation

  • Detergent screening: Test mild detergents (0.05% Triton X-100, 0.1% CHAPS) to improve solubility

  • Salt concentration: Test NaCl gradient (100-500 mM) to identify optimal ionic strength

Recovery Strategies:

  • On-column refolding: Apply denaturing-renaturing protocol during affinity purification

  • Solubilization and refolding: Solubilize inclusion bodies in 8M urea, then refold by dialysis

  • Mild solubilization: Try arginine-based buffers (0.5-1M) for extraction under milder conditions

When reporting purification results, document thoroughly the conditions tested and their outcomes to aid other researchers.

What controls are essential when studying ATL44-mediated ubiquitination in vitro and in vivo?

Robust controls are critical for reliable ubiquitination studies:

In Vitro Ubiquitination Controls:

Control TypePurposeImplementation
Negative enzyme controlsVerify E3 ligase specificityOmit E1, E2, or ATL44 individually
Catalytic mutantConfirm enzymatic mechanismMutate key Cys/His residues in RING domain
Substrate specificityDemonstrate selective activityInclude non-substrate proteins in reaction
Ubiquitin mutantsIdentify chain topologyUse K48R, K63R, or other Lys mutant ubiquitin
Inhibitor controlsValidate assay sensitivityInclude deubiquitinase inhibitors (e.g., NEM)

In Vivo Ubiquitination Controls:

  • Genetic controls:

    • Compare wild-type, atl44 knockout, and catalytically inactive ATL44 complementation lines

    • Include overexpression lines of wild-type and mutant ATL44

  • Treatment controls:

    • Include proteasome inhibitors (MG132) to stabilize ubiquitinated proteins

    • Use cycloheximide to distinguish degradation from synthesis effects

  • Substrate validation:

    • Demonstrate substrate stability changes correlate with ATL44 levels

    • Show reduced ubiquitination in atl44 mutants or with catalytically inactive ATL44

  • Ubiquitination verification:

    • Demonstrate direct ubiquitination through mass spectrometry identification of ubiquitin remnants

    • Verify chain topology using linkage-specific antibodies

When presenting ubiquitination data, include quantitative analysis of ubiquitination efficiency and substrate specificity using multiple biological replicates.

What emerging technologies could advance our understanding of ATL44 function?

Several cutting-edge technologies show promise for deepening our understanding of ATL44:

Advanced Imaging Approaches:

  • Super-resolution microscopy: Visualize ATL44 interactions at nanoscale resolution

  • FRET-FLIM: Measure real-time dynamics of ATL44-substrate interactions in living cells

  • Lattice light-sheet microscopy: Track ATL44 movements in 3D with minimal phototoxicity

Proteomics Innovations:

  • Targeted proteomics (PRM/MRM): Quantify low-abundance ATL44 and substrates with high sensitivity

  • Crosslinking mass spectrometry (XL-MS): Map interaction interfaces between ATL44 and binding partners

  • Ubiquitin remnant profiling: Identify ubiquitination sites globally in ATL44 mutants vs. wild-type

Genome Engineering:

  • Base editing: Generate precise point mutations in ATL44 without double-strand breaks

  • Prime editing: Introduce specific modifications to study structure-function relationships

  • CRISPR activation/interference: Modulate ATL44 expression without genetic modification

Single-Cell Technologies:

  • Single-cell RNA-seq: Map cell-specific responses to ATL44 perturbation

  • Single-cell proteomics: Analyze protein-level changes in individual cells

  • Spatial transcriptomics: Visualize ATL44 expression changes across tissues with spatial context

Computational Approaches:

  • AlphaFold2/RoseTTAFold: Predict ATL44 structure and interaction complexes

  • Molecular dynamics simulations: Model ATL44-substrate recognition dynamics

  • Network medicine approaches: Position ATL44 within cellular interaction networks

Combining these technologies in integrated research programs will provide unprecedented insights into ATL44 function and regulation.

How might ATL44 be involved in plant responses to biotic stresses and pathogen defense?

RING-H2 E3 ligases often play critical roles in plant immunity. Potential roles for ATL44 in biotic stress responses include:

Pattern-Triggered Immunity (PTI):

  • Possible regulation of pattern recognition receptors (PRRs) through ubiquitination

  • Potential modulation of early signaling components like BIK1 or MAPK cascades

  • Could influence ROS production machinery activity through targeted degradation

Effector-Triggered Immunity (ETI):

  • May regulate R-protein stability or activity

  • Could mediate degradation of negative regulators of hypersensitive response

  • Potential role in defense-related transcription factor regulation

Hormone-Mediated Defense:

  • Possible intersection with salicylic acid, jasmonate, or ethylene signaling pathways

  • May regulate crosstalk between defense hormone networks

  • Could influence NPR1 or JAZ protein stability

Experimental Approaches to Investigate Biotic Stress Roles:

  • Challenge atl44 mutants with diverse pathogens (bacteria, fungi, oomycetes)

  • Analyze defense marker gene expression in ATL44-modulated plants

  • Examine PTI/ETI-specific responses (ROS burst, MAPK activation, callose deposition)

  • Investigate changes in ATL44 expression, localization, or activity following pathogen perception

  • Identify defense-related proteins whose stability is affected by ATL44

Understanding ATL44's role in plant immunity will require integrating molecular studies with pathology assays and systems biology approaches to position it within defense networks.

How can findings about ATL44 be integrated with our understanding of RING-H2 proteins across plant species?

Integrating ATL44 research into the broader context of plant RING-H2 proteins requires:

  • Phylogenetic Framework Development:

    • Construct comprehensive phylogenies of plant RING-H2 proteins

    • Position ATL44 within evolutionary lineages to identify functional clades

    • Compare conservation patterns across monocots, dicots, and non-flowering plants

  • Functional Domain Mapping:

    • Align functional data across homologous proteins in different species

    • Identify conserved vs. species-specific functions within the ATL family

    • Create domain-function maps that correlate structural features with activity

  • Cross-Species Validation:

    • Test functional conservation through complementation studies across species

    • Examine substrate recognition specificity in different plant backgrounds

    • Investigate conservation of regulatory mechanisms controlling activity

  • Network Contextual Analysis:

    • Compare protein-protein interaction networks centered on ATL44 homologs

    • Identify conserved vs. variable network components

    • Develop models explaining divergence in network architecture

  • Synthesis of Developmental and Stress Roles:

    • Compare phenotypic effects of ATL mutations across species

    • Identify common patterns in developmental or stress response functions

    • Develop unified models of RING-H2 protein function in plant growth and adaptation

An integrated understanding of ATL44 will ultimately contribute to a broader model of how E3 ubiquitin ligase diversity contributes to plant adaptation and environmental response.

What are the methodological challenges in reconciling contradictory data about ATL44 function?

Resolving contradictory findings about ATL44 requires systematic investigation of methodological differences:

Sources of Experimental Variation:

  • Genetic background effects:

    • Compare ATL44 function in multiple ecotypes/accessions

    • Consider genetic modifiers that may vary between laboratories

    • Use identical genetic backgrounds when comparing results from different studies

  • Environmental variation:

    • Standardize growth conditions (light intensity, photoperiod, temperature, humidity)

    • Document subtle environmental parameters often overlooked (light quality, soil composition)

    • Test phenotypes across multiple controlled environments

  • Developmental timing:

    • Ensure precise staging of samples based on developmental markers, not just time

    • Consider circadian and diurnal effects on ATL44 function

    • Examine phenotypes across complete developmental series

Analytical Reconciliation Approaches:

  • Meta-analysis frameworks:

    • Systematically compare effect sizes across studies

    • Identify factors that correlate with outcome variation

    • Develop integrated models that account for methodological differences

  • Collaborative standardization:

    • Establish common experimental protocols across laboratories

    • Exchange biological materials to eliminate stock variations

    • Perform replicate experiments in multiple laboratories

  • Sensitivity analysis:

    • Systematically vary experimental parameters to identify critical factors

    • Develop quantitative models of how methodological variables affect outcomes

    • Establish boundary conditions for specific ATL44 functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.