Recombinant Arabidopsis thaliana RING-H2 finger protein ATL47 (ATL47)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
ATL47; At1g23980; T23E23.15; RING-H2 finger protein ATL47; RING-type E3 ubiquitin transferase ATL47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL47
Target Protein Sequence
MSERRIHYSQLKNDNLNQISPSSAPSPITLNHQLTDSSSSSSSGGNNRISPIILFIIVLL SVIFFICSILHLLVRYYLKKKRSNLSSSPNESNQNPEFSDSDTYQRQLQQLFHLHDSGLD QALIDALPVFLYKEIKGTKEPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDCIDTWLLSNS TCPLCRGTLFSLGHQFEYPDFNFGFFAGDDGGGGVRVSPVQKPAENEIGKRVFSVRLGKF RSSNIVNNGEVVVGGGGETSSSSLDNRRCFSMGSYQYIVAESDLVVALCPNNEGLKNNKD VEGKKINMRSKGESFSVSKIWQWSNKRSKFPNNHPSETNLVVGGSSSSSSYVCSGSDGLS LNGRRFQGP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G23980

STRING: 3702.AT1G23980.1

UniGene: At.41503

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL47 protein and what are its basic structural features?

ATL47 (AT1G23980) is a member of the Arabidopsis Tóxicos en Levadura (ATL) family of E3 ubiquitin ligases characterized by a specific RING-H2 finger domain and transmembrane regions. ATL proteins contain a canonical RING-H2 domain with six cysteines and two histidines that coordinate zinc ligation with exact spacing between them . The domain architecture typically includes:

  • N-terminal transmembrane helices (usually 22-24 residues long)

  • A conserved GLD motif (12-16 amino acids that often begins with glycine, leucine, and aspartic acid residues)

  • The RING-H2 domain with characteristic residue patterns

  • Variable C-terminal regions that differ significantly among family members

ATL47 shares structural features with other ATL family members, which typically contain three or fewer transmembrane helices (99.3% of cases), though rare exceptions with up to thirteen transmembrane helices have been documented .

How is ATL47 classified within the ATL family of proteins?

ATL47 is classified within the RING-H2 finger E3 ligase family of proteins in Arabidopsis thaliana. The ATL family is characterized by proteins that contain both a transmembrane domain and a RING-H2 finger domain . Classification is based on:

  • The presence of the canonical RING-H2 finger domain with specific spacing between zinc-coordinating residues

  • The presence of transmembrane helices toward the amino-terminus

  • The presence of the conserved GLD motif between the transmembrane regions and the RING-H2 domain

  • A conserved tryptophan residue spaced three residues downstream from the sixth zinc ligand

Phylogenetic analyses using complete gene sequences, concatenated motifs, or the 42 amino acid segment encompassing the RING-H2 domain help place ATL47 within the evolutionary context of this protein family .

What expression systems are most effective for producing recombinant ATL47?

Multiple expression systems have been validated for recombinant ATL47 production with varying advantages depending on research needs:

Expression SystemPurity LevelApplicationsSpecial Considerations
Cell-Free Expression≥85% by SDS-PAGERapid production, avoiding cellular toxicityUseful for potentially toxic proteins
E. coli≥85% by SDS-PAGEHigh yield, economical productionMay require optimization of codon usage
Yeast≥85% by SDS-PAGEPost-translational modificationsSlower than bacterial systems
Baculovirus≥85% by SDS-PAGEComplex eukaryotic processingBetter for large-scale production
Mammalian Cell≥85% by SDS-PAGEMost authentic post-translational modificationsHigher cost, longer production time

When selecting an expression system, researchers should consider whether the transmembrane domains of ATL47 might affect proper folding and solubility in bacterial systems, potentially necessitating the use of eukaryotic expression systems for functional studies .

What purification strategies yield the highest activity for recombinant ATL47?

For optimal ATL47 purification with retained activity, consider these methodological approaches:

  • For transmembrane proteins like ATL47, initial extraction using mild detergents (such as 0.5-1% Triton X-100 or n-dodecyl β-D-maltoside) helps solubilize without denaturing the protein

  • Implement a multi-step purification strategy:

    • Initial capture via affinity chromatography (His-tag or GST-tag depending on construct)

    • Intermediate purification through ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Quality assessment:

    • Purity validation by SDS-PAGE (target ≥85% purity)

    • Activity validation through in vitro ubiquitination assays

    • Protein identity confirmation via Western blot using specific antibodies

For retaining E3 ligase activity, researchers should carefully monitor buffer conditions, particularly reducing agents, as the RING-H2 domain contains critical zinc-coordinating cysteines that are essential for structural integrity and function.

What are the established functions of ATL47 in Arabidopsis development?

While specific functions of ATL47 are still being elucidated, research on related ATL family members provides valuable insights into potential roles. ATL family proteins, as E3 ubiquitin ligases, typically target specific proteins for degradation through the 26S proteasome.

Based on studies of other ATL proteins, particularly ATL5:

  • Developmental regulation: ATL5 positively regulates seed longevity by mediating the degradation of ABT1 (Activator of Basal Transcription 1) in Arabidopsis . This suggests ATL family members have critical roles in developmental processes.

  • Cellular mechanisms: ATL proteins like ATL5 participate in protein degradation through polyubiquitination, which influences cellular processes including cell division, elongation, and development .

  • Response patterns: Expression patterns of ATL proteins are often tissue-specific and can be induced by environmental stresses. For instance, ATL5 is highly expressed in seed embryos and its expression increases during accelerated aging .

Researchers investigating ATL47 specifically should examine expression patterns across different tissues and developmental stages to determine its unique functional contributions.

How does ATL47 compare to other E3 ligases in the ATL family?

ATL47 shares structural features with other members of the ATL family but also exhibits unique characteristics:

FeatureATL47ATL5Other ATLsSignificance
RING-H2 domainPresent with canonical spacingPresentPresentEssential for E3 ligase activity
Transmembrane helicesPresentPresentPresentMembrane localization
GLD motifPresentPresentPresent in ~82%Conserved feature between transmembrane helices and RING-H2 domain
Expression patternTissue-specificHigh in seed embryosVariesIndicates specialized functions
Interacting partnersUnder investigationABT1 identified via Y2HVaries by family memberDetermines biological function

The diversity in ATL protein architecture, particularly in regions adjacent to the core conserved domains, suggests functional specialization despite shared mechanisms . This comparison highlights the importance of characterizing specific interaction partners of ATL47 to understand its unique biological roles.

What techniques are most effective for studying ATL47 protein-protein interactions?

Several complementary approaches can effectively identify and validate ATL47 interaction partners:

  • Yeast Two-Hybrid (Y2H) Screening

    • Effective for initial identification of potential interactors

    • Similar approaches successfully identified ABT1 as an ATL5 interacting protein

    • Consider using the RING-H2 domain as bait to identify substrate proteins

  • Bimolecular Fluorescence Complementation (BiFC)

    • Validates interactions in planta

    • Provides spatial information about where interactions occur within plant cells

    • Successfully used to confirm interactions between ATL5 and ABT1

  • Co-Immunoprecipitation (Co-IP)

    • Confirms interactions in native or near-native conditions

    • Can be performed using antibodies against ATL47 or epitope-tagged versions

    • Validated approach for ATL family proteins as demonstrated with ATL5

  • In vitro Pull-Down Assays

    • Uses recombinant proteins to test direct interactions

    • Useful for determining binding domains through truncation analyses

    • Can be coupled with ubiquitination assays to test functional relevance

When designing these experiments, researchers should consider the transmembrane nature of ATL47, which may require specialized approaches for solubilization and maintaining protein folding during interaction studies.

How can researchers effectively assess the E3 ligase activity of ATL47?

To evaluate the E3 ligase activity of ATL47, researchers should implement these methodological approaches:

  • In vitro Ubiquitination Assays

    • Components needed: Purified recombinant ATL47, E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), ubiquitin, ATP, and potential substrate proteins

    • Detection methods: Western blotting with anti-ubiquitin antibodies to detect polyubiquitin chains

    • Controls: Include reactions without ATP, without E1/E2, or with catalytically inactive ATL47 mutants

  • Cell-Based Degradation Assays

    • Co-express ATL47 with potential substrates in plant protoplasts or heterologous systems

    • Monitor substrate levels with and without proteasome inhibitors (e.g., MG132)

    • Similar approaches confirmed ATL5-mediated degradation of ABT1 in proteasome-dependent manner

  • Quantitative Assessment

    • Measure degradation kinetics using cycloheximide chase assays

    • Compare substrate half-life in wild-type versus ATL47 mutant backgrounds

    • This approach revealed that disruption of ATL5 diminished the degradation of translated ABT1

  • Domain Function Analysis

    • Create point mutations in critical RING-H2 domain residues (particularly zinc-coordinating cysteines and histidines)

    • Compare activity of wild-type and mutant proteins to establish structure-function relationships

These methods collectively provide strong evidence for E3 ligase activity and help identify physiologically relevant substrates of ATL47.

What phenotypes are associated with ATL47 knockout or overexpression in Arabidopsis?

While specific phenotypes for ATL47 mutants are still being characterized, insights from related ATL family members provide valuable context:

  • Developmental Phenotypes

    • Based on studies of related E3 ligases, disruption of ATL47 may affect specific developmental processes

    • For comparison, ATL5 disruption led to faster seed aging compared to wild-type, while ATL5 overexpression restored normal phenotypes

    • Given the role of related E3 ligases in SCF complexes and their importance in embryogenesis, ATL47 mutants might show developmental defects

  • Environmental Response Phenotypes

    • ATL family members often show altered responses to environmental stresses

    • Researchers should examine ATL47 mutants under various stress conditions (drought, salinity, pathogen exposure)

    • Expression analysis showed that ATL5 expression could be induced by accelerated aging, suggesting stress-responsive regulation

  • Cellular and Molecular Phenotypes

    • Look for changes in target protein abundance or modification using proteomics approaches

    • Similar to how ATL5 regulates ABT1 levels, ATL47 likely controls specific target proteins

When designing experiments to characterize ATL47 mutants, researchers should consider potential redundancy with other ATL family members, which may necessitate creating higher-order mutants to observe clear phenotypes.

How does ATL47 interact with other components of the ubiquitin-proteasome system?

ATL47, as a RING-H2 type E3 ligase, functions within the broader ubiquitin-proteasome system through several key interactions:

  • E2 Enzyme Interactions

    • RING-H2 domains in ATL proteins interact with specific E2 ubiquitin-conjugating enzymes

    • Conserved residues in the RING-H2 domain, including the R-x₁-LP pattern upstream from the third zinc ligand, likely mediate these interactions

    • Researchers should conduct E2 profiling assays to identify which of the ~37 Arabidopsis E2s preferentially work with ATL47

  • SCF Complex Context

    • While ATL proteins are not typically part of SCF complexes, they function in parallel ubiquitination pathways

    • SCF complexes containing ASK1 and ASK2 are essential for Arabidopsis embryogenesis

    • Investigating genetic interactions between ATL47 and SCF components could reveal functional relationships

  • Substrate Recognition

    • The variable C-terminal region of ATL47 likely mediates substrate specificity

    • This region shows the most size variability among ATL proteins, potentially reflecting diverse substrate interactions

    • Protein interaction screens focusing on this region may identify specific ATL47 targets

  • Proteasomal Degradation

    • ATL47-mediated ubiquitination likely leads to proteasome-dependent degradation

    • This process can be experimentally verified using proteasome inhibitors like MG132

    • For comparison, ATL5-mediated degradation of ABT1 was shown to occur in a proteasome-dependent manner

Understanding these interactions is crucial for placing ATL47 within the cellular signaling networks that regulate plant development and stress responses.

What are the emerging approaches for identifying ATL47 substrates on a proteome-wide scale?

Several cutting-edge approaches can be employed to identify ATL47 substrates comprehensively:

  • Proximity-Dependent Biotinylation (BioID or TurboID)

    • Fuse ATL47 to a biotin ligase that biotinylates neighboring proteins

    • Identify biotinylated proteins via streptavidin pulldown and mass spectrometry

    • Advantages: Captures transient interactions; works in native cellular environment

  • Quantitative Proteomics Comparing Wild-Type and ATL47 Mutants

    • Use stable isotope labeling (SILAC) or tandem mass tag (TMT) approaches

    • Look for proteins that accumulate in ATL47 mutants compared to wild-type

    • Combine with proteasome inhibition to enrich for direct substrates

  • Ubiquitinome Analysis

    • Employ diGly remnant antibodies to enrich ubiquitinated peptides

    • Compare ubiquitination patterns between wild-type and ATL47 mutants

    • Identify sites with reduced ubiquitination in mutants

  • Integrative Multi-Omics Approaches

    • Combine transcriptomics, proteomics, and ubiquitinomics data

    • Use computational approaches to predict high-confidence substrates

    • Validate top candidates with targeted biochemical approaches

These approaches can be further enhanced by focusing on specific developmental stages or stress conditions where ATL47 function is likely to be most prominent, similar to how ATL5 function in seed longevity was identified .

How might structure-function analysis inform the design of ATL47 variants with altered specificity?

Structure-function analysis provides critical insights for engineering ATL47 variants with modified properties:

These structure-function analyses not only advance basic understanding of ATL47 but also enable the development of biotechnological tools for targeted protein degradation in plants.

How conserved is ATL47 across plant species and what does this reveal about its function?

Analysis of ATL47 conservation provides important evolutionary and functional insights:

Plant GroupATL47 HomologsKey DifferencesFunctional Implications
Brassicaceae (close relatives of Arabidopsis)Highly conservedMinor variations in C-terminal regionsCore functions likely conserved within family
Other DicotsPresent with moderate sequence similarityVariable C-terminal domainsPossible adaptation to species-specific functions
MonocotsDistant homologs identifiableMore significant sequence divergenceBasic E3 ligase function likely conserved, but with altered substrates
Non-flowering PlantsRemote homologs with core RING-H2 featuresSignificant differences in transmembrane and C-terminal regionsAncestral functions related to basic cellular processes

The strong conservation of the RING-H2 domain structure across plant species suggests fundamental importance in plant cellular function . The ATL family shows evidence of having been subjected to strong selection during evolution, with approximately 85% of proteins containing the canonical ATL RING-H2 domain also including a transmembrane helix across 17 of 24 examined plant genomes .

This pattern of conservation suggests that while the core ubiquitin ligase function is ancient and essential, the specific regulatory roles of ATL47 may have diversified during plant evolution to accommodate species-specific developmental and environmental response needs.

What experimental systems beyond Arabidopsis are valuable for studying ATL47 function?

Several experimental systems offer complementary advantages for studying ATL47 function:

  • Nicotiana benthamiana Transient Expression

    • Rapid expression of tagged ATL47 variants via Agrobacterium infiltration

    • Facilitates in vivo interaction studies using BiFC or co-immunoprecipitation

    • Useful for subcellular localization studies and preliminary phenotypic analyses

  • Heterologous Systems

    • Yeast: Test functional conservation by expressing ATL47 in ubiquitin pathway mutants

    • Mammalian cells: Examine substrate recognition in isolation from plant-specific factors

    • Advantages include powerful genetic tools and simplified background for biochemical studies

  • Crop Species Orthologs

    • Study ATL47 orthologs in economically important species like rice, wheat, or tomato

    • Examine conservation of function and potential agricultural applications

    • Link molecular mechanisms to traits of agricultural importance

  • Evolutionary Distant Plant Models

    • Physcomitrella patens (moss): Examine function in a basal land plant

    • Chlamydomonas reinhardtii: Study function in a unicellular relative of land plants

    • These systems help determine which functions are ancestral versus more recently evolved

When using these alternative systems, researchers should account for differences in cellular context, particularly regarding the availability of appropriate E2 enzymes and potential substrate proteins that might influence ATL47 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.