Recombinant Arabidopsis thaliana RING-H2 finger protein ATL51 (ATL51)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL51; At3g03550; T12J13.17; T21P5.3; RING-H2 finger protein ATL51; RING-type E3 ubiquitin transferase ATL51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL51
Target Protein Sequence
MGSTGNPNPWGTTYDSYRDCSQGVCSVYCPQWCYVIFPPPPSFYLDDEDDSSSSDFSPLL IALIGILASAFILVSYYTLISKYCHRRRHNSSSTSAAAINRISSDYTWQGTNNNNNNGAT NPNQTIGGGGGDGLDESLIKSITVYKYRKMDGFVESSDCSVCLSEFQENESLRLLPKCNH AFHVPCIDTWLKSHSNCPLCRAFIVTSSAVEIVDLTNQQIVTENNSISTGDDSVVVVNLD LENSRSRNETVNEGSTPKPPEMQDSRDGEERRSASLNSGGGVVSIADILREIEDDEESAG VGTSRWVEEGEGEKTPPPSGSAANQTNGISNFLVRSSMAAMKRSGYDRAKNYRLPK
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G03550

STRING: 3702.AT3G03550.1

UniGene: At.44888

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the ATL family and how is ATL51 classified within it?

The ATL (Arabidopsis Tóxicos en Levadura) family is a plant-specific multi-gene family encoding RING-H2 finger E3 ubiquitin ligases. In Arabidopsis thaliana, the genome encodes 91 ATL members . ATL51 is classified as a RING-H2 finger protein within this family, containing a characteristic RING-H2 domain that coordinates zinc ions in a cross-brace arrangement. The name "Tóxicos en Levadura" derives from the observation that some ATL proteins were toxic when overexpressed in yeast .

What is the domain architecture of ATL51?

ATL51 consists of 356 amino acids with several conserved domains typical of the ATL family :

  • A RING-H2 finger domain essential for E3 ligase activity

  • A hydrophobic region at the N-terminal end that likely functions as a transmembrane domain

  • A GLD (Glycine-rich) motif, named for three conserved amino acids found in the region

  • Additional protein-protein interaction domains that may be involved in substrate recognition

How is ATL51 different from other members of the ATL family?

While sharing core domains with other ATL family members, ATL51 has specific sequence features that differentiate it from other ATLs. The RING-H2 domain of ATL51 has a precise disposition of 8 zinc ligands along with other conserved amino acid residues . Unlike some ATLs like ATL2 and ATL63 that demonstrate toxicity when expressed in yeast, ATL51 has not been reported to show this phenotype, suggesting functional specialization within the family .

What is the function of ATL51 in Arabidopsis thaliana?

While the specific function of ATL51 has not been extensively characterized in the search results, as an ATL family member, it likely functions as an E3 ubiquitin ligase involved in protein degradation via the ubiquitin/26S proteasome pathway . Other characterized ATL family members have been implicated in various biological processes including defense responses, regulation of carbon/nitrogen metabolism, cell death regulation, and developmental processes .

How does the ubiquitin ligase activity of ATL proteins affect plant biology?

ATL proteins like ATL51 mediate the transfer of ubiquitin to target proteins, marking them for degradation. This process is crucial for various cellular functions including:

  • Protein quality control

  • Hormone signaling

  • Defense responses

  • Developmental transitions

  • Stress responses

For instance, ATL5 has been shown to positively regulate seed longevity by mediating the polyubiquitination and degradation of ABT1 (ACTIVATOR OF BASAL TRANSCRIPTION 1) . Similarly, ATL1 has been demonstrated to be a positive regulator of programmed cell death .

What cellular localization pattern does ATL51 exhibit?

Like many other ATL family members, ATL51 likely localizes to membrane systems due to its hydrophobic domain at the N-terminal. Other characterized ATLs have been shown to localize to the endoplasmic reticulum or trans-Golgi network/early endosome (TGN/EE) compartments. For instance, ATL1 has been observed to interact with EDR1 (ENHANCED DISEASE RESISTANCE1) on TGN/EE vesicles . Experimental verification of ATL51's specific localization would require cellular imaging studies with fluorescently tagged proteins.

How can recombinant ATL51 protein be produced for in vitro studies?

Recombinant ATL51 can be produced using bacterial expression systems such as E. coli . The methodology typically involves:

  • Cloning the full-length ATL51 coding sequence into an expression vector with a His-tag or other affinity tag

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression using IPTG or another inducer

  • Lysing the cells and purifying the protein using affinity chromatography

  • Performing quality control including SDS-PAGE and Western blot analysis

  • Reconstituting the purified protein in an appropriate buffer system

The resulting His-tagged recombinant protein can be stored as a lyophilized powder or in solution with 6% trehalose at -20°C/-80°C .

What methods can be used to verify the E3 ligase activity of ATL51?

The E3 ligase activity of ATL51 can be verified through several complementary approaches:

  • In vitro ubiquitination assays: Combining purified recombinant ATL51, E1 activating enzyme, E2 conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily), ubiquitin, ATP, and potential substrates, followed by detection of ubiquitinated products by immunoblotting .

  • Yeast two-hybrid assays: To identify potential interacting partners and substrates .

  • Bimolecular fluorescence complementation (BiFC): To confirm protein-protein interactions in plant cells .

  • Co-immunoprecipitation: To validate protein interactions identified through other methods .

  • Cell-free degradation assays: To assess the degradation of potential substrate proteins in the presence of ATL51 .

How can gene expression patterns of ATL51 be analyzed in different tissues and stress conditions?

Gene expression analysis of ATL51 can be performed using multiple approaches:

  • RNA-seq analysis: Utilizing existing databases like Expression Atlas for Arabidopsis thaliana to examine expression patterns across tissues and conditions.

  • Quantitative RT-PCR: For targeted analysis of ATL51 expression in specific tissues or under defined stress conditions.

  • Promoter-reporter fusions: Creating transgenic plants with ATL51 promoter fused to a reporter gene (like GUS or GFP) to visualize spatial and temporal expression patterns.

  • ePlant visualization tools: Using resources like ePlant (BAR) to visualize expression data across multiple experimental conditions, including abiotic stress responses .

  • Microarray data mining: Analyzing publicly available microarray datasets to identify conditions that induce ATL51 expression.

How can CRISPR-Cas9 genome editing be optimized for functional studies of ATL51?

For CRISPR-Cas9 modification of ATL51, researchers should consider:

  • Guide RNA design: Target conserved functional domains like the RING-H2 finger to disrupt E3 ligase activity. Design multiple sgRNAs targeting different exons to increase editing efficiency.

  • Off-target analysis: Use tools like Cas-OFFinder to minimize off-target effects by selecting guides with minimal homology to other genomic regions.

  • Transformation strategy: Either Agrobacterium-mediated transformation or direct protoplast transformation can be used, with selection of appropriate markers.

  • Verification of mutations:

    • PCR amplification followed by sequencing

    • T7 endonuclease I assay for mutation detection

    • Western blotting to confirm protein loss

  • Complementation analysis: Reintroduce wild-type ATL51 to confirm phenotype rescue and rule out off-target effects.

  • Multiplex editing: Consider editing multiple ATL family members simultaneously to address functional redundancy issues.

What approaches can identify E2 ubiquitin-conjugating enzyme partners for ATL51?

Identifying the specific E2 partners for ATL51 is crucial for understanding its function. Based on studies of other ATL proteins, the following approaches can be employed:

  • Yeast-based screening: Test interactions with multiple Arabidopsis E2 enzymes, with particular focus on the Ubc4/Ubc5 subfamily which has been shown to interact with several ATLs .

  • In vitro binding assays: Using purified recombinant ATL51 and various E2 proteins to measure direct physical interaction through techniques like surface plasmon resonance.

  • Structural analysis: NMR spectroscopy to determine the three-dimensional structure of ATL51's RING-H2 domain and identify key amino acids for E2 binding, similar to studies performed with rice EL5 .

  • Mutational analysis: Introducing point mutations in conserved residues of the RING-H2 domain to disrupt specific E2 interactions.

  • Protein pull-down assays: Using tagged ATL51 to pull down interacting E2 enzymes from plant extracts, followed by mass spectrometry identification.

How does ATL51 compare to ATL5 in terms of substrate specificity and function?

While both ATL51 and ATL5 belong to the same protein family, their functions appear distinct:

  • Functional difference: ATL5 has been characterized as mediating the polyubiquitination and degradation of ABT1, positively affecting seed longevity . The specific function and substrates of ATL51 remain to be fully characterized.

  • Domain architecture comparison: Analyzing the sequence and structural differences between ATL5 and ATL51, particularly in regions involved in substrate recognition, may provide insights into their functional divergence.

  • Expression pattern analysis: Comparing expression patterns of ATL5 and ATL51 across tissues and conditions using databases like Expression Atlas could indicate different biological roles.

  • Evolutionary analysis: Phylogenetic analysis of ATL5 and ATL51 across different plant species could reveal their evolutionary relationship and functional conservation.

  • Cross-complementation studies: Determining whether ATL51 can functionally substitute for ATL5 in atl5 mutant plants would provide insights into their functional overlap.

What are the potential substrates of ATL51 and how can they be identified?

Identification of ATL51 substrates is challenging but crucial for understanding its biological function. Several approaches can be employed:

  • Proximity-based labeling: Using BioID or TurboID fused to ATL51 to biotinylate nearby proteins, followed by streptavidin pulldown and mass spectrometry.

  • Global proteomics approach: Compare protein abundance in wild-type vs. atl51 mutant plants to identify proteins that accumulate in the absence of ATL51.

  • Ubiquitin remnant profiling: Identify ubiquitinated proteins in wild-type vs. atl51 mutant plants using antibodies that recognize the diglycine remnant left on ubiquitinated lysines after trypsin digestion.

  • Yeast two-hybrid screening: Screen for ATL51-interacting proteins that might represent potential substrates.

  • Co-immunoprecipitation coupled with mass spectrometry: Pull down ATL51 complexes and identify associated proteins.

  • Bioinformatics prediction: Use machine learning approaches trained on known E3 ligase-substrate pairs to predict potential ATL51 substrates.

How does the structure of the RING-H2 domain in ATL51 influence its function and E2 specificity?

The RING-H2 domain structure is critical for ATL51's function as an E3 ligase:

  • Structural analysis: NMR or X-ray crystallography of ATL51's RING-H2 domain can reveal the precise three-dimensional arrangement of zinc-coordinating residues and other conserved amino acids.

  • Mutational analysis: Systematic mutation of conserved residues in the RING-H2 domain can identify those critical for ubiquitination activity, similar to studies performed with the rice ATL family member EL5 .

  • Comparative structural analysis: Compare the structure of ATL51's RING-H2 domain with other ATL family members to identify unique features that might confer functional specificity.

  • Molecular docking: In silico modeling of ATL51 interactions with different E2 enzymes can predict the molecular basis of E2 specificity.

  • Chimeric protein analysis: Creating chimeric proteins by swapping RING-H2 domains between different ATL proteins to determine if E2 specificity and function can be transferred.

How does understanding ATL51 function contribute to plant stress response research?

Many ATL family members are involved in plant stress responses. Researching ATL51 may contribute to understanding:

  • Stress-responsive protein degradation: ATL proteins often mediate the degradation of regulatory proteins in response to stress conditions. ATL51 may target specific proteins for degradation under particular stress conditions.

  • Crosslink with hormone signaling: Many E3 ligases including ATL family members regulate hormone signaling components. ATL51 might function in stress-hormone crosstalk.

  • Early signaling events: Several ATL family members are early PAMP-responsive genes . ATL51 may similarly be involved in early defense signaling.

  • Genetic engineering applications: Understanding ATL51's function could lead to strategies for engineering plants with enhanced stress tolerance by modifying specific protein degradation pathways.

  • Evolutionary adaptations: Comparative studies of ATL51 across plant species may reveal evolutionary adaptations in stress response mechanisms.

What technologies are being developed to study protein-protein interactions involving ATL51?

Advanced technologies for studying ATL51 interactions include:

  • Split-ubiquitin membrane yeast two-hybrid systems: Particularly useful for membrane-associated proteins like ATL51.

  • FRET/FLIM analysis: For studying protein interactions in living plant cells with high spatial resolution.

  • Single-molecule pull-down: To detect transient or weak interactions that might be missed by traditional approaches.

  • Cryo-electron microscopy: For structural analysis of ATL51 complexes.

  • Hydrogen-deuterium exchange mass spectrometry: To map interaction interfaces between ATL51 and its partners.

  • Optical tweezers or atomic force microscopy: To measure binding forces between ATL51 and its substrates or E2 partners.

  • Proximity-dependent biotin identification (BioID): For identifying proteins in close proximity to ATL51 in living cells.

How can computational approaches aid in predicting ATL51 function and evolution?

Computational approaches offer powerful tools for ATL51 research:

  • Homology modeling: Predict the 3D structure of ATL51 based on solved structures of related proteins.

  • Molecular dynamics simulations: Simulate the dynamic behavior of ATL51 and its interactions with partners.

  • Sequence-based phylogenetic analysis: Understand the evolutionary history of ATL51 and its relationship to other ATL family members.

  • Gene co-expression network analysis: Identify genes co-expressed with ATL51 to predict its biological pathways.

  • Machine learning approaches: Predict potential substrates based on features of known E3-substrate pairs.

  • Synteny analysis: Compare the genomic context of ATL51 across plant species to gain insights into its evolutionary conservation and potential function.

  • Protein-protein interaction network analysis: Position ATL51 within the broader cellular protein interaction network to predict its functional role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.