Recombinant Arabidopsis thaliana RING-H2 finger protein ATL52 (ATL52)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATL52; At5g17600; K10A8_80; RING-H2 finger protein ATL52; RING-type E3 ubiquitin transferase ATL52
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL52
Target Protein Sequence
MSTNPNPWSPYDSYNDCSQGICNIYCPQWCYLIFPPPPPSFFLDDDSSSSSSSFSPLLIA
LIGILTSALILVSYYTLISKYCHRHHQTSSSETLNLNHNGEGFFSSTQRISTNGDGLNES
MIKSITVYKYKSGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHLPCIDTWLKSHSNC
PLCRAFVTGVNNPTASVGQNVSVVVANQSNSAHQTGSVSEINLNLAGYESQTGDFDSVVV
IEDLEIGSRNSDARSELQLPEERRETKDEDSLPIRRSVSLNSGVVVSIADVLREIEDEEG
ESGGVGTSQRREEGEDGDGKTIPPTEANQRSGGVSGFFVRSLSTGRFIFSRYDRGRNYRL
PL
Uniprot No.
Target Background
Database Links
Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in flowers.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
