Recombinant Arabidopsis thaliana RING-H2 finger protein ATL5 (ATL5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ATL5; At3g62690; F26K9_120; RING-H2 finger protein ATL5; RING-type E3 ubiquitin transferase ATL5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL5
Target Protein Sequence
MGNLFDSSKTLWGNMNHGSSRYSLNGKIMLASVIILFVAVILILCFHSYARWLFRRQNRR IRRRISAHLRSLAAARDPTQSSSSLSPLDPTVLEKIPIFVYSVKTHESPLEECSVCLSEF EEDDEGRVLPKCGHVFHVDCIDTWFRSRSSCPLCRAPVQPAQPVTEPEPVAAVFPSVKPI EDTEAGSSSSSDESESSTPSSSSGSPVRFPMEACEREPIDLVGIIVEIPREFQDSNSDLP ADNGSNRRASLKRLWII
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G62690

STRING: 3702.AT3G62690.1

UniGene: At.4826

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL5 and how is it classified within the Arabidopsis proteome?

ATL5 (ARABIDOPSIS TÓXICOS EN LEVADURA 5) is a RING-H2 finger protein belonging to the ATL family of E3 ubiquitin ligases in Arabidopsis thaliana. The ATL family represents one of the 477 RING finger E3 ligases encoded in the Arabidopsis genome . This protein contains the characteristic RING-H2 domain, which is a variation of the canonical RING finger with a precise arrangement of 8 zinc ligands and other conserved amino acid residues essential for its function as an E3 ligase . ATL5 exhibits the common structural features of ATL family members, including the RING-H2 domain (region VI), a hydrophobic amino acid-rich region that likely functions as a transmembrane domain (region II), and the conserved GLD region (region IV) whose function remains under investigation .

What is the primary biological function of ATL5 in Arabidopsis thaliana?

ATL5 functions as an E3 ubiquitin ligase that positively regulates seed longevity in Arabidopsis thaliana. It specifically mediates the polyubiquitination and subsequent proteasomal degradation of ACTIVATOR OF BASAL TRANSCRIPTION 1 (ABT1) . Recent research has demonstrated that ATL5 is highly expressed in seed embryos, and its expression can be induced during seed aging processes . Through targeted degradation of ABT1, ATL5 contributes to maintaining seed viability during extended storage periods, making it an important factor in seed biology and agricultural applications .

How does the structure of ATL5 relate to its function?

The structure of ATL5, like other members of the ATL family, includes a characteristic RING-H2 domain that is fundamental to its E3 ligase activity. This domain contains precisely arranged cysteine and histidine residues that coordinate zinc ions in a specific conformation necessary for binding to E2 ubiquitin-conjugating enzymes . Functional studies with related ATL proteins have shown that the key amino acid residues within the RING-H2 domain are critical for E2 binding and subsequent ubiquitination activity . The hydrophobic region in ATL5 likely serves as a transmembrane domain, potentially localizing the protein to cellular membranes. Together, these structural elements enable ATL5 to recognize its substrate (ABT1) and facilitate its ubiquitination, marking it for degradation by the 26S proteasome .

What are the recommended methods for recombinant expression and purification of ATL5?

For recombinant expression of ATL5, the most effective approach involves:

  • Vector Selection: Utilizing a pET-based expression system with an N-terminal His-tag for purification purposes.

  • Expression Host: E. coli BL21(DE3) strains are recommended due to their reduced protease activity.

  • Induction Conditions: Expression should be induced with 0.5 mM IPTG at lower temperatures (16-18°C) for 16-18 hours to enhance protein solubility.

  • Lysis Conditions: Cell lysis should be performed in buffers containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 5 mM β-mercaptoethanol, with the addition of zinc ions (10-20 μM ZnCl₂) to stabilize the RING-H2 domain.

  • Purification Strategy: Affinity chromatography using Ni-NTA resin followed by size exclusion chromatography is effective for obtaining pure protein.

It's crucial to maintain reducing conditions throughout purification to prevent oxidation of the cysteine residues in the RING-H2 domain, which could compromise the zinc coordination and functional activity of ATL5 .

How can researchers effectively assay ATL5's E3 ligase activity in vitro?

To assay ATL5's E3 ligase activity in vitro, researchers should implement the following protocol:

  • Components Required:

    • Purified recombinant ATL5 (1-5 μg)

    • E1 ubiquitin-activating enzyme (50-100 nM)

    • E2 ubiquitin-conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily, 0.5-1 μM)

    • Ubiquitin (10-50 μM)

    • ATP regeneration system (2 mM ATP, 5 mM MgCl₂, 10 mM creatine phosphate, 1 unit creatine phosphokinase)

    • Purified substrate protein (ABT1, 0.5-1 μM)

  • Reaction Conditions:

    • Buffer: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 2 mM ATP, 0.5 mM DTT

    • Temperature: 30°C

    • Time: 1-2 hours

  • Detection Methods:

    • Western blotting using anti-ubiquitin antibodies to detect polyubiquitin chains

    • SDS-PAGE with Coomassie staining to observe substrate mobility shifts

    • Fluorescently labeled ubiquitin for real-time monitoring of ubiquitination

For optimal results, include appropriate controls such as reactions without ATP, without E3 ligase, or with mutated versions of ATL5 (particularly mutations in the RING-H2 domain) to confirm specificity of the ubiquitination activity .

What techniques can be used to study ATL5-substrate interactions?

Several complementary techniques can be employed to characterize ATL5-substrate interactions:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Effective for initial identification of potential substrates

    • Successfully used to identify ABT1 as an ATL5 interacting protein

    • Requires careful design of bait constructs to avoid autoactivation

  • Bimolecular Fluorescence Complementation (BiFC):

    • Allows visualization of protein interactions in planta

    • Split YFP or other fluorescent protein fragments are fused to ATL5 and potential substrate

    • Confirmed the interaction between ATL5 and ABT1 in plant cells

  • Co-Immunoprecipitation (Co-IP):

    • Validates interactions in native or near-native conditions

    • Can be performed with epitope-tagged versions of ATL5 and substrate proteins

    • Provides evidence for physical association in plant tissues

  • In Vitro Pull-Down Assays:

    • Uses purified recombinant proteins to test direct interactions

    • GST or His-tagged ATL5 can be used to pull down potential substrate proteins

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC):

    • Provides quantitative binding parameters (Kd, stoichiometry)

    • Useful for characterizing the strength and specificity of interactions

These techniques should be used in combination to provide robust evidence for authentic substrate interactions and to distinguish true substrates from other interacting proteins .

How does ATL5 specifically recognize its substrate ABT1 for ubiquitination?

The molecular basis of substrate recognition by ATL5 likely involves specific protein-protein interactions between recognition motifs on ATL5 and corresponding features on ABT1. While the exact recognition mechanism hasn't been fully elucidated, research suggests a multi-step process:

  • Recognition Domains: Regions outside the RING-H2 domain in ATL5 likely mediate substrate recognition. The GLD region (region IV) common in ATL family proteins may play a role in substrate specificity .

  • Post-translational Modifications: ABT1 may require specific modifications (phosphorylation, glycosylation, etc.) to be recognized by ATL5. This represents a potential regulatory mechanism that could be induced during seed aging .

  • Structural Complementarity: Molecular docking studies would be valuable to identify potential interaction interfaces between ATL5 and ABT1.

  • Co-factors: Additional adaptor proteins might facilitate the interaction between ATL5 and ABT1, analogous to SCF complex components in other E3 ligase systems.

Future research using site-directed mutagenesis of both ATL5 and ABT1, followed by interaction assays and in vitro ubiquitination experiments, would help identify the critical residues involved in this specific recognition process .

What is the significance of ATL5's role in seed longevity and how does it impact agricultural applications?

ATL5's role in regulating seed longevity has significant implications for both basic plant biology and agricultural applications:

  • Molecular Mechanism: ATL5 positively regulates seed longevity by mediating the polyubiquitination and degradation of ABT1. Seeds with disrupted ATL5 function demonstrate accelerated aging compared to wild-type seeds, while expressing ATL5 in atl5-2 mutants essentially restores normal seed longevity .

  • Physiological Impact: The degradation of ABT1 appears to be induced during seed aging and occurs in a proteasome-dependent manner. Disruption of ABT1 enhances seed longevity, suggesting that ABT1 may negatively affect seed viability during storage .

  • Agricultural Applications:

    • Extended seed viability during storage would reduce waste and improve germination rates

    • Potential for developing varieties with improved seed storage characteristics

    • Possible application in conservation efforts for rare plant species

  • Biotechnological Approaches: Engineering ATL5 expression levels or activity could potentially be used to enhance seed longevity in commercially important crop species, although careful evaluation of potential pleiotropic effects would be necessary.

This research highlights the importance of protein degradation pathways in seed biology and identifies specific molecular targets for improving seed quality and storage capabilities .

How do environmental stresses affect ATL5 expression and activity?

ATL5 expression and activity appear to be responsive to environmental stresses, particularly those related to seed aging:

  • Expression Regulation: ATL5 is highly expressed in seed embryos, and its expression can be induced by accelerated aging conditions . This suggests that ATL5 may be part of a stress response mechanism activated during seed deterioration.

  • Stress-Induced Activity: The ubiquitination and degradation of ABT1 mediated by ATL5 is enhanced during seed aging, indicating that ATL5's activity may be upregulated under stress conditions .

  • Potential Signaling Pathways: While not fully characterized for ATL5 specifically, other ATL family members are known to be regulated by various stress signaling pathways, including:

    • Reactive oxygen species (ROS) signaling

    • Hormonal pathways (particularly abscisic acid, which is important in seed dormancy)

    • Temperature and desiccation stress responses

  • Post-translational Regulation: Environmental stresses may affect ATL5 activity through post-translational modifications of ATL5 itself or by altering the availability or modification status of its substrate, ABT1.

Further research using transcriptomic and proteomic approaches under various stress conditions would help elucidate the complete regulatory network controlling ATL5 expression and activity in response to environmental challenges .

What are common challenges in working with recombinant ATL5 and how can they be overcome?

Researchers working with recombinant ATL5 frequently encounter several challenges:

  • Protein Solubility Issues:

    • Challenge: RING-H2 domain proteins often aggregate during expression.

    • Solution: Express at lower temperatures (16°C) with reduced IPTG concentration (0.1-0.2 mM). Adding zinc ions (10-20 μM ZnCl₂) to growth media and purification buffers helps stabilize the RING-H2 domain structure.

  • Maintaining E3 Ligase Activity:

    • Challenge: Loss of activity during purification due to oxidation of zinc-coordinating cysteines.

    • Solution: Include reducing agents (5 mM DTT or 5 mM β-mercaptoethanol) in all buffers and handle samples under nitrogen atmosphere when possible.

  • Substrate Specificity:

    • Challenge: Determining true in vivo substrates versus promiscuous in vitro activity.

    • Solution: Validate substrate interactions using multiple approaches (Y2H, BiFC, Co-IP) and confirm the biological relevance through in planta experiments with ATL5 mutants .

  • E2 Enzyme Selection:

    • Challenge: Identifying the correct E2 partner for in vitro ubiquitination assays.

    • Solution: Based on studies with other ATL family members, E2 enzymes from the Ubc4/Ubc5 subfamily are likely to function with ATL5 . Test multiple E2 enzymes in parallel reactions.

  • Expression System Selection:

    • Challenge: Bacterial expression systems may not provide proper folding or modifications.

    • Solution: Consider insect cell or plant-based expression systems for more authentic protein production, especially for functional studies.

Careful optimization of these parameters will significantly improve the quality and reliability of experiments with recombinant ATL5.

How can researchers generate and characterize ATL5 mutants to study its function?

To generate and characterize ATL5 mutants for functional studies:

  • Types of Mutations to Consider:

    • RING-H2 Domain Mutations: Target the conserved cysteine and histidine residues that coordinate zinc. These mutations typically abolish E3 ligase activity without affecting substrate binding.

    • Substrate Recognition Mutations: Target residues outside the RING-H2 domain, particularly in the GLD region, to affect substrate specificity.

    • Transmembrane Domain Mutations: Alter the hydrophobic region to affect cellular localization.

  • Mutagenesis Methods:

    • Site-Directed Mutagenesis: For specific amino acid changes

    • CRISPR/Cas9: For generating plant lines with genomic mutations

    • T-DNA Insertion Lines: Utilize available Arabidopsis T-DNA insertion collections

  • Functional Characterization Approaches:

    • In Vitro Ubiquitination Assays: Compare wild-type and mutant ATL5 activity

    • Yeast Complementation: Test if mutants can restore phenotypes in yeast systems

    • Plant Phenotyping: Examine seed longevity in plants expressing ATL5 mutants

    • Protein Interaction Studies: Determine if mutations affect binding to ABT1 or E2 enzymes

  • Recommended Controls:

    • Include wild-type ATL5 in all experiments

    • Use known inactive RING mutants as negative controls

    • Confirm proper protein expression and stability of all mutants

    • Verify subcellular localization is not disrupted (unless intended)

  • Data Analysis:

    • Quantify ubiquitination activity relative to wild-type protein

    • Analyze seed longevity data using appropriate statistical methods

    • Consider age-dependent effects in phenotypic analyses

This systematic approach will help establish clear structure-function relationships for ATL5 .

What controls are essential when studying ATL5-mediated ubiquitination in vivo?

When studying ATL5-mediated ubiquitination in vivo, the following controls are essential:

  • Genetic Controls:

    • ATL5 Knockout/Knockdown Lines: Essential to establish baseline without ATL5 activity

    • ATL5 Complementation Lines: Wild-type ATL5 should rescue knockout phenotypes

    • Catalytically Inactive ATL5 Mutants: RING-H2 domain mutants should not rescue phenotypes

    • ABT1 Knockout Lines: Should phenocopy or enhance ATL5 overexpression phenotypes

  • Biochemical Controls:

    • Proteasome Inhibitors: Treatment with MG132 should block ABT1 degradation if the mechanism is proteasome-dependent

    • Protein Synthesis Inhibitors: Cycloheximide chase experiments to distinguish regulation at protein stability versus transcriptional levels

    • Immunoprecipitation Controls: Non-specific IgG and input samples in Co-IP experiments

  • Experimental Design Controls:

    • Time Course Analysis: Monitor ubiquitination and degradation over time

    • Tissue Specificity: Examine effects in different tissues (especially embryo vs. non-embryonic tissues)

    • Stress Conditions: Compare normal versus accelerated aging conditions

    • Developmental Stages: Analyze effects at different seed development and germination stages

  • Technical Controls:

    • Antibody Specificity Verification: Validate all antibodies with appropriate positive and negative controls

    • RNA/Protein Extraction Quality: Ensure consistent quality across all samples

    • Loading Controls: Use stable reference proteins or total protein staining methods

These controls will help establish the specificity and biological significance of ATL5-mediated ubiquitination events in vivo .

What are the cutting-edge technologies being applied to study ATL5 function?

Several cutting-edge technologies are advancing our understanding of ATL5 function:

  • Proximity-Dependent Labeling Techniques:

    • BioID or TurboID fusions with ATL5 can identify spatial proteomes and transient interactions

    • Allows identification of the complete interactome beyond known substrates like ABT1

    • Helps map ATL5's involvement in specific cellular compartments

  • Single-Cell Omics Approaches:

    • Single-cell RNA-seq to identify cell-specific expression patterns of ATL5

    • Single-cell proteomics to detect cell-type specific changes in ABT1 levels

    • Spatial transcriptomics to map ATL5 expression patterns within seed tissues

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy to visualize ATL5 localization at subcellular level

    • FRET/FLIM to study dynamic protein interactions in living cells

    • Optogenetic tools to control ATL5 activity with light in specific cells/tissues

  • Structural Biology Approaches:

    • Cryo-EM to determine the structure of ATL5 in complex with E2 enzymes and substrates

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • AlphaFold2/RoseTTAFold predictions to model protein structures and interactions

  • CRISPR-Based Technologies:

    • Base editing for precise modification of ATL5 coding sequence

    • CRISPRi/CRISPRa for temporal control of ATL5 expression

    • Prime editing for introducing specific mutations without donor DNA

These technologies provide unprecedented resolution and control for studying ATL5's function in plants .

How can computational approaches enhance our understanding of ATL5 function and evolution?

Computational approaches offer powerful tools for investigating ATL5:

  • Structural Modeling and Docking:

    • Predict ATL5 3D structure using AlphaFold2 or RoseTTAFold

    • Model ATL5-ABT1 interaction interfaces through protein-protein docking

    • Simulate the dynamics of these interactions using molecular dynamics

    • Identify potential small molecule binding sites for functional studies

  • Evolutionary Analysis:

    • Phylogenetic analysis of ATL family across plant species

    • Identification of conserved functional motifs through multiple sequence alignment

    • Detection of selection signatures to identify functionally important residues

    • Coevolution analysis between ATL5 and its substrates

  • Network Biology Approaches:

    • Integration of protein-protein interaction, transcriptomic, and phenotypic data

    • Pathway enrichment analysis to place ATL5 in broader biological contexts

    • Network perturbation simulations to predict systemic effects of ATL5 modulation

    • Multi-omics data integration to build comprehensive models of ATL5 function

  • Machine Learning Applications:

    • Prediction of novel ATL5 substrates based on known interaction features

    • Identification of regulatory elements controlling ATL5 expression

    • Classification of seed longevity phenotypes based on ATL5-related markers

    • Feature extraction from high-dimensional phenotypic data

These computational approaches can generate testable hypotheses about ATL5 function, guide experimental design, and help interpret complex datasets .

What are the future directions for ATL5 research in the context of plant stress biology?

Future ATL5 research in plant stress biology should focus on:

  • Mechanistic Understanding:

    • Elucidating the complete signaling pathway connecting environmental stresses to ATL5 activation

    • Identifying additional substrates of ATL5 beyond ABT1

    • Determining how ATL5-mediated ubiquitination coordinates with other post-translational modifications

    • Characterizing potential feedback mechanisms regulating ATL5 activity

  • Environmental Adaptation:

    • Investigating ATL5 function across diverse environmental conditions

    • Examining natural variation in ATL5 sequences and activity among ecotypes

    • Assessing how ATL5 contributes to stress memory and transgenerational effects

    • Determining if ATL5 function varies in response to climate change-related stresses

  • Agricultural Applications:

    • Developing molecular markers for seed quality based on ATL5 pathway components

    • Engineering improved seed longevity through targeted modification of ATL5 activity

    • Exploring ATL5 orthologs in crop species for conservation breeding

    • Creating diagnostic tools to predict seed performance under storage conditions

  • Integration with Other Stress Response Systems:

    • Investigating crosstalk between ATL5 and hormone signaling pathways

    • Examining connections between ATL5 and ROS signaling during seed aging

    • Exploring potential interactions with epigenetic regulators of stress responses

    • Determining how ATL5 integrates with broader proteostasis networks

  • Innovative Methodologies:

    • Developing ATL5 activity biosensors for real-time monitoring in living seeds

    • Creating inducible systems for temporal control of ATL5 activity

    • Establishing high-throughput phenotyping platforms for seed quality assessment

    • Implementing synthetic biology approaches to engineer novel ATL5 functions

These research directions will advance both fundamental understanding of plant stress biology and practical applications in agriculture and conservation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.