Recombinant Arabidopsis thaliana RING-H2 finger protein ATL60 (ATL60)

Shipped with Ice Packs
In Stock

Description

General Information

Arabidopsis thaliana RING-H2 finger protein ATL60 (ATL60) is a protein belonging to the Really Interesting New Gene (RING) finger E3 ubiquitin ligase family . These proteins, characterized by a RING-H2 domain, play crucial roles in various plant biological processes, including growth, stress response, and signal transduction . The Arabidopsis thaliana genome encodes a large number of E3 ligases, with the ATL (Arabidopsis Tóxicos en Levadura) family being a significant group within them .

Arabidopsis thaliana, also known as thale cress, is a model organism for plant research.

The ATL Family

The ATL family in Arabidopsis thaliana is composed of 91 members, all containing the RING-H2 variation and an N-terminal hydrophobic domain . These transmembrane E3 ligases participate in several biological processes, such as endoplasmic reticulum-associated degradation pathway, defense responses, carbon/nitrogen response regulation, cell death regulation during root development, endosperm development, and the transition to flowering under short-day conditions . The ATL family has also contributed to studies on gene family expansion in plant genomes .

Function of RING-H2 Finger Proteins

RING-H2 finger proteins, including ATL60, are involved in various abiotic stress signaling pathways in plants . They can modulate plant hormone responses, such as those related to abscisic acid (ABA), auxin (IAA), ethylene (ETH), jasmonic acid (JA), and salicylic acid (SA) . These phytohormones are essential in plant adaptation to environmental stresses, and RING-H2 proteins can act as regulators by mediating different signaling pathways .

Role in Stress Response

The Solanum habrochaites RING-H2 finger gene, ShATL78L, shows a strong response to various stresses like cold, drought, salt, heat, and wounding . Overexpression of ShATL78L in cultivated tomato plants enhances tolerance to cold, drought, and oxidative stresses .

Expression and Regulation

The expression of genes like ShATL78L can be induced by various plant hormone treatments, suggesting their role as balance regulators in response to abiotic stresses . Transcription factors like RAV2 can bind to the promoter of ShATL78L and regulate its expression, while interactions with proteins like CSN5B can also modulate abiotic stress responses .

E3 Ubiquitin Ligases

E3 ubiquitin ligases, such as those in the ATL family, are a major class of genes in the ubiquitination pathway . Arabidopsis thaliana has approximately 1400 predicted E3 genes . RING finger domains are common in E3 ligases, with Arabidopsis thaliana containing 477 RING finger E3 ligases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL60; At1g53820; T18A20.16; RING-H2 finger protein ATL60; RING-type E3 ubiquitin transferase ATL60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL60
Target Protein Sequence
MDEESVSNGSLFSKFEGEETMGKVLLFSIVSIFTGILFLLLLHLYARLFWWRVEQHFNLN LIQSDDPGSTVIGRNPRRRRFVFAQSQEDPLHNAGLDSKILQSIHVVVFKCTDFKDGLEC AVCLSDLVDGDKARVLPRCNHGFHVDCIDMWFQSHSTCPLCRNTVGSVEDTTHGGSEGLP QNQNFESGHSTNQHNPSQDQSFVHEFSTEPLSFPTNVLVWGDQNQVRSAGLVVTEESPSG NFAASYNDHQQESSSTRSQEVTAVVVDIPDNSSENLSERIDEEEPKSPMFTRLRLLKNVL SREKTNNNNV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G53820

STRING: 3702.AT1G53820.1

UniGene: At.52187

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of ATL60 and how does it relate to other members of the ATL family?

ATL60 belongs to the Arabidopsis Tóxicos En Levadura (ATL) subfamily of RING-type E3 ubiquitin ligases that are widely conserved across plant species. Similar to other ATL proteins, ATL60 contains a characteristic RING-H2 finger domain critical for its ubiquitin ligase activity. The ATL family typically includes a transmembrane domain located toward the N-terminal end, which anchors these proteins to cellular membranes .

To characterize ATL60's structure:

  • Perform sequence alignment analysis with other well-studied ATL proteins (such as ATL2, ATL6, ATL31)

  • Confirm the presence of conserved domains using protein structure prediction tools

  • Validate protein localization using fluorescent tagging and microscopy techniques

The ATL family in Arabidopsis encompasses approximately fifteen sequences that share highly homologous RING domains while exhibiting variation in other regions, suggesting functional specialization among family members .

What are the established experimental methods for expressing recombinant ATL60 protein?

When expressing recombinant ATL60, researchers typically employ similar protocols to those used for other ATL family proteins:

Table 1: Common Expression Systems for Recombinant ATL Proteins

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, rapid growthPotential misfolding of plant proteinsCodon optimization required
Yeast systemsBetter post-translational modificationsLower yield than E. coliOriginal ATL name derives from toxicity in yeast
Plant expression systemsNative modifications, proper foldingLower yield, time-consumingPreferred for functional studies
Insect cellsGood for membrane proteinsMore complex setupBest for structural studies

For optimal results:

  • Clone the full ATL60 coding sequence into an expression vector with an appropriate tag (His, GST, etc.)

  • Transform into the chosen expression system

  • Induce expression under optimized conditions

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Validate protein identity by western blotting and mass spectrometry

Given the membrane-associated nature of most ATL proteins, special attention should be paid to solubilization conditions when extracting the recombinant protein .

How can I reliably detect expression levels of ATL60 in Arabidopsis tissues?

Detection of ATL60 expression requires sensitive and specific techniques:

  • RT-qPCR Analysis: Design gene-specific primers that distinguish ATL60 from other ATL family members. Reference genes should be carefully selected for normalization based on the experimental conditions.

  • Western Blotting: Use antibodies specific to ATL60 or to an epitope tag if using transgenic plants expressing tagged ATL60. Given the high homology among ATL family members, antibody specificity should be rigorously validated.

  • Promoter-Reporter Fusions: Similar to approaches used with ATL2, construct transgenic Arabidopsis plants carrying the ATL60 promoter fused to a reporter gene (GUS or fluorescent protein) to visualize tissue-specific expression patterns .

  • RNA-Seq Analysis: For genome-wide expression profiling, RNA-seq can detect low-abundance transcripts and provide comparative expression data across conditions.

Table 2: Troubleshooting ATL60 Detection Methods

MethodCommon IssueSolution
RT-qPCRCross-amplification of homologous ATLsDesign primers in unique regions, validate specificity
Western blotLow protein abundanceUse enrichment/immunoprecipitation before detection
Promoter fusionInsufficient reporter signalOptimize fixation and staining protocols
RNA-SeqSequence mapping ambiguityApply stringent mapping parameters, validate with RT-qPCR

What stress conditions are known to induce ATL60 expression?

Based on knowledge of other ATL family members, ATL60 may respond to various biotic and abiotic stressors. ATL genes have been documented to respond rapidly to various stimuli, suggesting roles in early signaling events:

  • Biotic Stress: Members of the ATL family like ATL2 show rapid induction after exposure to chitin or inactivated crude cellulase preparations, indicating potential roles in plant immunity responses to pathogens .

  • Abiotic Stress: ATL31 and ATL6 are induced by salt stress and positively regulate salt stress responses .

To determine specific conditions inducing ATL60:

  • Perform time-course experiments exposing Arabidopsis plants to various stressors

  • Monitor ATL60 expression using RT-qPCR or promoter-reporter systems

  • Compare with expression patterns of known stress-responsive genes

  • Validate findings using multiple biological replicates

For abiotic stress testing, standardized stress application protocols should be followed to ensure reproducibility across laboratories.

What experimental design would best elucidate the functional redundancy between ATL60 and other ATL family members?

To investigate functional redundancy within the ATL family:

Systematic Approach:

  • Generate and Characterize Mutant Lines:

    • Create single, double, and higher-order mutants (e.g., atl60, atl60 atl61, etc.)

    • Use CRISPR-Cas9 for targeted mutagenesis if T-DNA insertions are unavailable

    • Employ near-isogenic line populations to minimize background effects

  • Complementation Assays:

    • Express different ATL genes under the ATL60 promoter in the atl60 background

    • Quantify the degree of phenotype rescue

  • Domain Swap Experiments:

    • Generate chimeric proteins swapping domains between ATL60 and other family members

    • Test functionality of these chimeras in appropriate mutant backgrounds

  • Multi-omics Analysis:

    • Compare transcriptomes, proteomes, and metabolomes of single and multiple ATL mutants

    • Identify unique and overlapping molecular networks

Table 3: Functional Redundancy Assessment Matrix

ATL Family MemberSequence Similarity to ATL60 (%)Shared Expression PatternsPhenotypic Overlap with atl60Potential Redundancy Score (1-5)
ATL1[To be determined][To be determined][To be determined][To be determined]
ATL2[To be determined]Rapid induction to chitin[To be determined][To be determined]
ATL6[To be determined]Salt stress response[To be determined][To be determined]
ATL31[To be determined]Salt stress response[To be determined][To be determined]
ATL69[To be determined][To be determined][To be determined][To be determined]

The data table should be completed through systematic experimentation, documenting the degree of similarity and functional overlap between ATL60 and other family members.

How can I resolve data contradictions when studying ATL60 ubiquitination targets and pathways?

Data contradictions are common when studying complex protein interaction networks like those involving E3 ubiquitin ligases. A structured approach to identifying and resolving these contradictions includes:

  • Parameter Classification System:

    • Apply a notation system similar to (α, β, θ) where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of Boolean rules needed to assess these contradictions .

    • For example, if you have contradicting reports about two potential ATL60 target proteins, this would be a (2,1,1) class contradiction.

  • Standardized Experimental Protocols:

    • Ensure uniform experimental conditions across comparative studies

    • Document all variables that might affect outcomes (plant age, growth conditions, protein extraction methods)

  • Multi-method Validation:

    • Confirm protein interactions using complementary techniques:

      • Yeast two-hybrid (Y2H)

      • Co-immunoprecipitation (Co-IP)

      • Bimolecular fluorescence complementation (BiFC)

      • In vitro ubiquitination assays

  • Biological Context Consideration:

    • Test interactions under different conditions that might affect ATL60 activity (e.g., stress vs. normal conditions)

    • Examine cell-type specificity of interactions

Table 4: Data Contradiction Resolution Framework for ATL60 Studies

Contradiction TypeExampleInvestigation ApproachResolution Strategy
Target identificationProtein X identified as target in Y2H but not in Co-IPTest interaction under various conditionsDetermine context-specific factors affecting interaction
Phenotypic effectsDifferent phenotypes in atl60 mutants between studiesStandardize growth conditionsIdentify environmental variables affecting phenotype
Pathway assignmentATL60 implicated in two incompatible pathwaysTemporal and spatial expression analysisDetermine if ATL60 functions differently based on context
Functional redundancyContradicting results from single vs. multiple mutantsHigher-order mutant analysisEstablish genetic interaction map

What approaches can be used to identify specific ubiquitination targets of ATL60?

Identifying E3 ligase targets requires a comprehensive strategy:

  • Proximity-based Labeling:

    • Fuse ATL60 to promiscuous biotin ligases (BioID or TurboID)

    • Identify proximal proteins by streptavidin pulldown followed by mass spectrometry

    • Validate direct interactions with candidate targets

  • Ubiquitinome Analysis:

    • Compare ubiquitinated proteomes between wild-type and atl60 mutant plants using quantitative proteomics

    • Focus on proteins with decreased ubiquitination in mutants

    • Perform parallel analysis with ATL60 overexpression lines

  • In vitro Ubiquitination Assays:

    • Express and purify recombinant ATL60 and candidate substrates

    • Perform reconstituted ubiquitination reactions

    • Analyze by western blot and mass spectrometry

  • Genetic Suppressor Screens:

    • Identify mutations that suppress atl60 phenotypes

    • Map these suppressors to identify potential downstream targets

Table 5: Comparison of ATL60 Target Identification Methods

MethodAdvantagesLimitationsData Analysis ApproachSuccess with Other ATL Proteins
BioID/TurboIDCaptures transient interactionsIdentifies proximity, not direct ubiquitinationSAINT algorithm for filtering[To be determined]
Ubiquitinome analysisDirectly measures ubiquitinationCannot distinguish direct from indirect effectsDifferential abundance analysisUsed with ATL31/ATL6
In vitro assaysConfirms direct activityArtificial conditions may not reflect in vivo realityBand shift analysis, mass specStandard for E3 ligases
Genetic screensReveals functional relationshipsLabor-intensive, may miss redundant targetsMapping-by-sequencing[To be determined]

How does ATL60 protein stability regulation compare with other ATL family members, and what methodologies best capture these dynamics?

Understanding protein stability regulation is crucial for characterizing E3 ubiquitin ligases:

  • Half-life Determination:

    • Employ cycloheximide (CHX) chase assays to block protein synthesis and monitor degradation rates

    • Compare degradation kinetics between ATL60 and other family members (ATL31, ATL6, etc.)

    • Include proteasome inhibitors (MG132) to confirm proteasome-dependent degradation

  • Stress-induced Degradation Patterns:

    • Based on findings that NaCl treatment induces proteasomal degradation of ATL31 proteins , investigate whether ATL60 undergoes similar stress-induced degradation

    • Test multiple stress conditions to create a comprehensive degradation profile

  • Auto-ubiquitination Analysis:

    • Determine if ATL60 undergoes auto-ubiquitination like many RING E3 ligases

    • Create catalytically inactive mutants to distinguish auto-ubiquitination from other degradation mechanisms

  • Post-translational Modification Mapping:

    • Identify phosphorylation, SUMOylation, or other modifications that might regulate ATL60 stability

    • Use mass spectrometry to map modification sites

    • Create site-directed mutants to test their functional significance

Table 6: Comparative Protein Stability Dynamics of ATL Family Members

ATL ProteinBasal Half-lifeStress-induced DegradationRegulatory ModificationsRegulatory Mechanisms
ATL60[To be determined][To be determined][To be determined][To be determined]
ATL31[Data needed]Degraded upon NaCl treatment [Data needed]Proteasome-dependent
ATL6[Data needed][Data needed][Data needed][Data needed]
ATL2[Data needed][Data needed][Data needed][Data needed]

This comparative analysis would provide valuable insights into conserved and divergent regulatory mechanisms across the ATL family.

What is the optimal experimental design for investigating ATL60's role in abiotic stress responses?

Based on the documented involvement of ATL31 and ATL6 in salt stress responses , investigating ATL60's role in abiotic stress would benefit from a systematic approach:

  • Genetic Material Preparation:

    • Generate atl60 knockout/knockdown lines, ATL60 overexpression lines, and complementation lines

    • Create tagged versions (GFP, FLAG, etc.) for protein localization and immunoprecipitation

    • Consider higher-order mutants with other ATL genes to address redundancy

  • Stress Treatment Matrix:

    • Test multiple stressors: salt, drought, cold, heat, oxidative stress

    • Apply different intensities and durations of stress

    • Monitor both acute and chronic stress responses

  • Multi-level Phenotyping:

    • Morphological: growth parameters, root architecture, cell death

    • Physiological: photosynthetic efficiency, ion leakage, ROS accumulation

    • Molecular: stress-responsive gene expression, hormone levels

  • Pathway Analysis:

    • Test interactions with known stress signaling components

    • Determine if ATL60 functions within or independent of the ABA pathway (ATL31/6 function independently of ABA )

    • Identify ubiquitination targets under stress conditions

Table 7: Comprehensive Abiotic Stress Testing Protocol for ATL60 Function

Stress TypeTreatment ConditionsPhenotypic ParametersMolecular MarkersControl Genotypes
Salt stress0, 50, 100, 150 mM NaClSurvival rate, root growthSOS1, RD29A expressionatl31 atl6 (salt tolerant)
DroughtWithholding water, 10-20% PEGRelative water content, ABA levelsDREB2A, RD29BWild-type, known drought mutants
Cold4°C for 1-7 daysElectrolyte leakage, anthocyaninCBF genes, COR15AWild-type, cbf mutants
Heat37-42°C for 1-24 hoursThermotolerance, Hsp expressionHsfA2, Hsp70Wild-type, hsf mutants
OxidativeH₂O₂, paraquat treatmentCell death, lipid peroxidationAPX, CAT, SOD expressionWild-type, antioxidant mutants

This comprehensive approach would establish whether ATL60 plays roles in stress responses similar to or distinct from those of ATL31 and ATL6.

How can the functional characterization of ATL60 contribute to our understanding of the ATL family evolution?

The ATL gene family has evolved to encompass multiple members with potentially specialized functions. Thorough characterization of ATL60 would contribute to understanding:

  • Functional Diversification:

    • Compare substrate specificity across ATL family members

    • Analyze expression patterns and tissue specificity

    • Determine if ATL60 has unique or overlapping functions with other family members

  • Evolutionary Analysis:

    • Conduct phylogenetic analysis of ATL proteins across plant species

    • Identify conserved and divergent domains through sequence analysis

    • Correlate structural changes with functional adaptation

  • Systems Biology Integration:

    • Map the position of ATL60 within the broader ubiquitin-proteasome system

    • Model the regulatory networks involving multiple ATL proteins

    • Predict emergent properties of these networks under various conditions

ATL family members like ATL31 and ATL6 regulate both biotic and abiotic stress responses , suggesting that these proteins may have evolved to integrate multiple stress signaling pathways. Determining whether ATL60 shares this dual functionality would provide insights into the evolutionary trajectory of this important protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.