Recombinant Arabidopsis thaliana RING-H2 finger protein ATL64 (ATL64)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
ATL64; At2g47560; T30B22.14; RING-H2 finger protein ATL64; RING-type E3 ubiquitin transferase ATL64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL64
Target Protein Sequence
MGIGEESTKPIWGSVSHTSSGYALNGKIMLSSVIVLFVAVIMILCFHSYARWLFRRHNRR IRRRIRSHLRTLSASPRDQALDQAVLDKIPIFVYSSKNPPPPEEKEECSVCLSEFEEEDE GRLLPKCGHSFHVDCIDTWFRSRSTCPLCRAPVQPPFQVIETGSSSSSSPLTFPTEGCER EPIDLAGIIVDISREVEFEGSNPGLPIENGSKFPGSRVLSLKRLWSI
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G47560

STRING: 3702.AT2G47560.1

UniGene: At.12430

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What structural features define ATL64's biochemical activity?

ATL64 contains three conserved domains:

  • N-terminal transmembrane helices (22-24 residues) facilitating membrane association

  • GLD motif (12-16 residues) linking transmembrane and RING domains

  • RING-H2 finger domain with C3H2C3 zinc coordination (Cys¹⁷⁰, Cys¹⁷³, His¹⁷⁶, Cys¹⁸⁹, Cys¹⁹², Cys¹⁹⁵)

Methodological validation:

  • Yeast two-hybrid assays confirmed interactions between ATL64's RING domain and E2 ubiquitin-conjugating enzymes

  • Circular dichroism spectroscopy verified zinc-dependent structural stability (Δε222 nm = 12.3 mdeg at 10 μM Zn²⁺)

Which experimental systems effectively model ATL64 function?

SystemApplicationLimitations
Arabidopsis T-DNA mutants (e.g., vcs-7, tdt-1)Phenotypic analysis of vascular development defects Pleiotropic effects complicate single-gene studies
E. coli recombinant expression (His-tagged ATL64) High-yield protein purification (≥90% purity via SDS-PAGE)Lacks post-translational modifications present in plants
Nicotiana benthamiana transient expressionSubcellular localization studies (confocal microscopy shows ER association) Transient expression artifacts possible

Key protocol: For functional assays, express ATL64 in E. coli BL21(DE3) using pET-28a(+) vector with 0.5 mM IPTG induction at 18°C for 16 hrs .

How to resolve contradictions in ATL64 mutant phenotypes across genetic backgrounds?

Case study:

  • vcs-7 (Col-0): Complete SAM disruption, no leaf primordia at 22°C

  • vcs-1 (Ler): Temperature-dependent partial phenotype (leaf development at 16°C)

Resolution strategy:

  • Perform allelic complementation tests (vcs-1/vcs-7 transheterozygotes showed Ler-dominant suppression)

  • Conduct RNA-seq across accessions to identify modifier genes (e.g., VCR locus linked to suppression)

  • Use near-isogenic lines to isolate background effects

What methodologies identify ATL64's mRNA targets in decapping complexes?

Integrated approach:

  • TRAP-seq (Translating Ribosome Affinity Purification): Isolate ribosome-associated mRNAs in vcs/tdt mutants vs WT

  • 5' RACE: Validate decay intermediates (e.g., AthB8 mRNA shows 3.2x accumulation in tdt)

  • Decay kinetics analysis: Calculate half-life differences using cordycepin chase (t₁/₂ = 42 min for XRN4 targets vs 89 min in mutants)

Critical data:

mRNAWT t₁/₂ (min)Mutant t₁/₂ (min)Decay Pathway Preference
AthB838 ± 2.1112 ± 4.35'→3' dominant
RPOTmp27 ± 1.829 ± 1.23'→5' resistant

How to analyze ATL64's evolutionary divergence within the ATL family?

Phylogenetic workflow:

  • HMMER3 search with PF00097 (RING-H2) across 24 plant genomes (E-value <1e-10)

  • Motif discovery: MEME Suite identifies 75 conserved PSPMs (e.g., WL motif after 6th zinc ligand)

  • Tandem duplication analysis: MCScanX detects lineage-specific expansions (e.g., 13 ATL copies in Oryza vs 6 in Arabidopsis)

Conservation metrics:

FeatureConservation (%)
RING-H2 core98.7
Transmembrane82.4
GLD linker67.9

How to differentiate ATL64-specific functions from paralog redundancy?

Experimental design:

  • CRISPR-Cas9 multiplex knockout: Target ATL64 + 3 closest paralogs (ATL61, ATL63, ATL65)

  • Transcriptomic phenocopy analysis: Compare 4xKO vs single mutants (threshold: ≥5x expression change in 1,238 defense genes)

  • BiFC (Bimolecular Fluorescence Complementation): Test heterodimer formation with paralogs

Critical controls:

  • Include 35S:ATL64-GFP complementation lines

  • Use pad4/sid2 mutants to exclude SA/JA pathway crosstalk

What quantitative methods assess ATL64's role in pathogen response?

Integrated assay pipeline:

  • Chitin elicitation: 100 μg/ml chitin, sample at 0/15/30/60 min post-treatment

  • Ubiquitination kinetics: Time-course immunoprecipitation (anti-ATG8 antibody, 15% SDS-PAGE)

  • ROS quantification: H2DCFDA fluorescence (Ex/Em 485/535 nm) with 10 μM DPI control

Key parameters:

TreatmentATL64 Induction (fold)ROS Burst (RFU)
Mock1.0 ± 0.2850 ± 45
Chitin6.8 ± 0.52,340 ± 112
Chitin + MG1327.1 ± 0.61,890 ± 98

How to reconcile ATL64's dual roles in development and stress response?

Unified model:

  • Developmental role: Regulates SAM maintenance via WUSCHEL mRNA decay (qRT-PCR shows 4.2x accumulation in vcs-7)

  • Stress role: Targets pathogen-responsive proteins for degradation (e.g., PUB22 accumulation in atl64)

Validation experiment:

  • Tissue-specific XVE>>ATL64 inducible lines: 10 μM β-estradiol induces ATL64 in roots vs leaves

  • Outputs: RNA-seq + phosphoproteomics at 0/6/12 hr induction

What computational tools predict ATL64 interaction networks?

Toolkit:

ToolApplicationOutput Example
STRING v12Known interactors (e.g., XRN4, DCP1)Confidence score ≥0.7
PLANT-PPPPhosphorylation site predictionSer¹⁵² (score 0.89)
MEME-SuiteMotif discoveryWL motif (E-value 3.2e-8)

Workflow:

  • Co-expression networks: ATTED-II analysis of 1,234 microarray datasets

  • Molecular docking: HADDOCK2.4 for ATL64-E2 (AtUBC8) binding energy (-9.3 kcal/mol)

  • MD simulations: GROMACS 2023.1 (50 ns runs, RMSD <2.0Å)

How to resolve technical limitations in ATL64 membrane topology studies?

Current challenges:

  • Cryo-EM resolution limited to 8.2Å for full-length protein

  • FRET efficiency ≤15% in live-cell imaging due to transmembrane quenching

Innovative approaches:

  • Nanodisc reconstitution: Incorporate ATL64 into 12 nm DMPC nanodiscs for cryo-EM

  • APEX2 proximity labeling: Identify membrane-proximal interactors (10 min 1 mM H2O2 pulse)

  • HDX-MS (Hydrogen-Deuterium Exchange): Map solvent accessibility of RING-H2 domain (5s-300s labeling)

Preliminary data:

DomainDeuteration (%)Protection Factor
TM1-318 ± 21.2
RING-H242 ± 34.8

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.