Recombinant Arabidopsis thaliana RING-H2 finger protein ATL66 (ATL66)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL66 (ATL66) is a protein that, in Arabidopsis thaliana, is encoded by the gene At3g11110 . ATL66 belongs to the ATL (Arabidopsis Tóxicos en Levadura) family of RING-H2 E3 ubiquitin ligases . E3 ubiquitin ligases, such as ATL66, are enzymes that facilitate the transfer of ubiquitin to target proteins, thereby marking them for degradation or altering their function . The RING-H2 finger domain is a specific type of zinc finger domain consisting of a particular arrangement of cysteine and histidine residues that coordinate zinc ions .

Structure and Function

The ATL family, to which ATL66 belongs, includes 91 members in Arabidopsis thaliana and contains a RING-H2 variation and a hydrophobic domain at the N-terminal end . These transmembrane E3 ligases participate in biological processes, such as the endoplasmic reticulum-associated degradation pathway, which targets misfolded proteins . The RING-H2 domain, characteristic of ATL66 and other members of this family, directly binds to the E2 enzyme, which is essential for ubiquitination activity .

Expression and Localization

ATL66 is expressed as a full-length protein consisting of 158 amino acids . The protein contains a RING-H2 finger domain, a hydrophobic region, and a GLD region . The hydrophobic region may function as a transmembrane domain .

Role in Plant Defense

ATL2, a related member of the ATL family, is involved in the plant defense signaling pathway . Mutants with ectopic expression of ATL2 also show induced expression of defense-related genes, suggesting a role in plant immunity . While specific functions of ATL66 have not been as extensively characterized, its membership in the ATL family and the presence of the RING-H2 domain suggest that it may function similarly to other ATLs .

Interactions

ATL proteins, including ATL66, interact with E2 ubiquitin-conjugating enzymes . For example, the activity of ATL2 relies on members of the Ubc4/Ubc5 subfamily of E2 conjugases .

Research Findings

  • Gene Family Expansion: The ATL family demonstrates how gene families expand in plant genomes, making ATL66 relevant in evolutionary studies .

  • E3 Ligase Activity: As a RING-H2 finger protein, ATL66 functions as an E3 ubiquitin ligase, participating in the ubiquitination pathway .

  • Stress Response: RING-finger proteins, including ATL66, are involved in plant growth, stress resistance, and signal transduction .

Data Table

FeatureDescription
Protein NameRING-H2 finger protein ATL66
Gene NameATL66
Ordered Locus NamesAt3g11110
OrganismArabidopsis thaliana
Molecular WeightInquire
Tag InformationDetermined during production
Storage BufferTris-based buffer, 50% glycerol
Amino Acid SequenceMTSSSPSPQASmLLYWHENQYDDRNFQIHGRTLFFALALFSVVLFFALLTLYIHRNCLPRDSINLHASSPDRLTRCRSGGLDPAEIRSLPVVLCRRERAEEEEEKECCICLGGFEEGEKMKVLPPCSHCYHCECVDRWLKTESSCPLCRVSIRVDSSS
Expression Region1-158
FunctionE3 ubiquitin ligase
Related InformationKEGG: ath:AT3G11110STRING: 3702.AT3G11110.1UniGene: At.53265

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
ATL66; At3g11110; F11B9.7; F9F8.8; RING-H2 finger protein ATL66; RING-type E3 ubiquitin transferase ATL66
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL66
Target Protein Sequence
MTSSSPSPQASMLLYWHENQYDDRNFQIHGRTLFFALALFSVVLFFALLTLYIHRNCLPR DSINLHASSPDRLTRCRSGGLDPAEIRSLPVVLCRRERAEEEEEKECCICLGGFEEGEKM KVLPPCSHCYHCECVDRWLKTESSCPLCRVSIRVDSSS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G11110

STRING: 3702.AT3G11110.1

UniGene: At.53265

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL66 and what is its functional role in Arabidopsis thaliana?

ATL66 belongs to the ATL (Arabidopsis Toxicos en Levadura) family of E3 ubiquitin ligases in Arabidopsis thaliana. This protein contains a transmembrane domain that anchors it to cellular membranes and a RING-H2 finger domain that facilitates ubiquitin transfer to target proteins, marking them for degradation by the proteasome .

The ATL family in Arabidopsis comprises approximately 80 members, compared to 121 in rice (Oryza sativa), suggesting different evolutionary pathways across plant species . As an E3 ligase, ATL66 likely participates in cellular protein quality control mechanisms, potentially targeting specific proteins for degradation in response to developmental cues or environmental stresses.

Studies of the ATL family have revealed that these proteins are involved in various physiological processes, including defense responses, hormone signaling, and developmental regulation. The specific substrates of ATL66 remain to be fully characterized, but its function is likely critical for maintaining protein homeostasis in plant cells.

What is the structural composition and domain organization of ATL66?

ATL66, like other ATL family proteins, contains several key structural components that define its function:

  • A transmembrane domain (22-24 residues) at the amino-terminus, which anchors the protein to cellular membranes, likely the endoplasmic reticulum .

  • The GLD motif, a conserved region positioned between the transmembrane and RING-H2 domains that may facilitate protein-protein interactions .

  • The RING-H2 finger domain, a specialized zinc-binding structure of approximately 42 amino acids that coordinates two zinc atoms through a specific pattern of cysteine and histidine residues . This domain is essential for E3 ligase activity.

  • A variable carboxy-terminal region following the RING-H2 domain, which may confer substrate specificity .

How does ATL66 function within the ubiquitin-proteasome system?

ATL66, as a RING-H2 E3 ubiquitin ligase, functions as part of the ubiquitin-proteasome system, which is responsible for targeted protein degradation in eukaryotic cells. The process involves several steps:

  • Ubiquitin activation by an E1 enzyme in an ATP-dependent manner.

  • Transfer of activated ubiquitin to an E2 conjugating enzyme.

  • ATL66, as an E3 ligase, facilitates the transfer of ubiquitin from the E2 enzyme to specific substrate proteins .

  • This process can be repeated to form polyubiquitin chains on the substrate, which serves as a degradation signal.

  • Polyubiquitinated proteins are recognized by the 26S proteasome and degraded.

Research on related proteins has shown that proper proteasome assembly and function are critical for ERAD (Endoplasmic Reticulum-Associated Degradation) . For instance, the yeast protein Add66p (which is not directly related to ATL66 but provides insight into proteasome function) has been identified as a proteasome assembly chaperone (PAC), and its deletion reduces the chymotrypsin-like activity of the proteasome .

How can protein-protein interactions of ATL66 be identified and characterized?

Understanding ATL66's interactions is crucial for determining its functional roles. Several complementary approaches should be considered:

Yeast Two-Hybrid (Y2H) Screening:
Y2H has been successfully used to identify regions in ATL proteins that mediate protein-protein interactions . For membrane proteins like ATL66, modified approaches such as split-ubiquitin Y2H may be necessary.

Co-Immunoprecipitation:
Express epitope-tagged ATL66 (e.g., myc-tagged, similar to the approach used for Add66p ) in plant systems, followed by immunoprecipitation and mass spectrometry to identify interacting partners.

In Vitro Binding Assays:
Using purified recombinant ATL66 (particularly the RING-H2 domain), conduct pull-down assays with potential E2 conjugating enzymes and substrate proteins.

Crosslinking Mass Spectrometry:
Apply chemical crosslinking followed by mass spectrometry to capture transient interactions between ATL66 and its substrates or regulatory partners.

Data from these experiments should be systematically recorded in tables following the format guidelines outlined in search result , ensuring consistent precision and proper units for all measurements.

What experimental approaches are essential for analyzing ATL66 expression patterns?

Understanding when and where ATL66 is expressed provides critical insights into its physiological roles:

Transcriptional Analysis:

  • Quantitative RT-PCR to measure ATL66 expression across tissues and under various conditions.

  • RNA-seq for genome-wide expression profiling to identify co-regulated genes.

  • In situ hybridization to visualize tissue-specific expression patterns.

Translational and Post-translational Analysis:

  • Western blotting with specific antibodies against ATL66 or epitope tags.

  • Immunohistochemistry to visualize protein localization in plant tissues.

  • Translational fusions with reporter proteins (GFP, YFP) to monitor expression and localization in vivo.

Promoter Analysis:

  • Generation of promoter-reporter gene fusions (e.g., ATL66 promoter driving GUS or luciferase).

  • Deletion analysis to identify key regulatory elements in the promoter.

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the ATL66 promoter.

Data should be recorded using properly structured tables with clear headings, consistent precision, and complete datasets .

How should researchers analyze and present data from ATL66 functional studies?

Data Collection and Organization:

  • Record raw data in structured tables with clear column headings, units, and measurement uncertainty .

  • Maintain consistent precision across measurements and ensure complete data sets .

  • For each experiment, include appropriate controls (positive, negative, and technical).

Statistical Analysis:

  • Calculate means and standard deviations for biological replicates.

  • Apply appropriate statistical tests (t-test, ANOVA) to determine significance.

  • Consider multiple testing corrections when analyzing large datasets.

Example Data Table for ATL66 Expression Analysis:

Tissue/ConditionBiological Rep 1Biological Rep 2Biological Rep 3Mean ± SDStatistical Significance
Leaf (Control)1.000.951.051.00 ± 0.05Reference
Leaf (Drought)2.352.452.402.40 ± 0.05p < 0.001
Root (Control)0.650.700.750.70 ± 0.05Reference
Root (Drought)1.851.901.801.85 ± 0.05p < 0.001

The information in data tables must be clear and obvious to anyone who sees it, with numbers in every space and consistent precision (significant digits) .

What bioinformatic approaches are useful for analyzing ATL66 in the context of the ATL family?

Comprehensive bioinformatic analysis provides evolutionary and structural insights:

Sequence Analysis and Phylogenetics:

  • Multiple sequence alignment of ATL family members to identify conserved residues.

  • Phylogenetic tree construction to determine ATL66's relationship to other family members.

  • Classification into one of the 9 ATL groups identified in previous research .

  • Analysis of gene duplication events and evolutionary patterns.

Motif and Domain Analysis:

  • Identification of conserved motifs using tools like MEME.

  • Generation of position-specific probability matrix (PSPM) LOGOs to visualize conserved regions .

  • Structural prediction of domains using tools like Phyre2.

  • Transmembrane topology prediction using TMHMM Server .

Genomic Context Analysis:

  • Investigation of chromosomal location and potential clustering with other ATL genes.

  • Analysis of tandem duplications that may indicate functional diversification .

  • Comparison of syntenic regions across plant species.

These approaches should be integrated to build a comprehensive understanding of ATL66's evolutionary history and potential functions.

How can contradictions in ATL66 research be systematically analyzed and resolved?

Scientific research often produces contradictory results that require systematic analysis. Based on the netnography approach described in search result , researchers studying ATL66 should:

Identify Types of Contradictions:

  • Dilemmas: Incompatible evaluations of ATL66 function or localization .

  • Conflicts: Direct oppositions in experimental outcomes from different studies .

  • Critical conflicts: Situations where researchers face contradictory motives in experimental design .

  • Double binds: Seemingly unresolvable problems in the research process .

Methodology for Contradiction Analysis:

  • Data Collection: Systematically document contradictory findings from literature or collaborative discussions using the Collaborative Forum approach .

  • Categorization: Classify contradictions into the four types mentioned above (as shown in Box 3 of search result ).

  • Linguistic Analysis: Identify linguistic markers that signal contradictions in research communications .

  • Impact Assessment: Analyze how contradictions affect research progress and understanding of ATL66.

Resolution Strategies:

  • Design experiments that specifically address the contradiction.

  • Employ multiple complementary techniques to verify results.

  • Consider that apparent contradictions may reflect actual biological complexity rather than experimental errors.

  • Standardize experimental protocols across research groups.

What are the optimal experimental designs for investigating ATL66 function in planta?

Comprehensive investigation of ATL66 function requires multiple complementary approaches:

Genetic Approaches:

  • Loss-of-function studies: Generate T-DNA insertion mutants or CRISPR/Cas9 knockouts.

  • Gain-of-function studies: Create overexpression lines using constitutive or inducible promoters.

  • Domain-specific mutations: Introduce point mutations in the RING-H2 domain to disrupt ligase activity.

  • Complementation experiments: Express wild-type ATL66 in knockout backgrounds to confirm phenotype rescue.

Phenotypic Analysis:

  • Comprehensive evaluation across developmental stages.

  • Response to various stresses (drought, salt, pathogens).

  • Hormone sensitivity assays.

  • Detailed morphological and cellular analyses.

Molecular Analysis:

  • Transcriptome profiling (RNA-seq) in mutant vs. wild-type plants.

  • Ubiquitinome analysis to identify potential substrates.

  • Proteome analysis to identify changes in protein abundance.

Interaction Studies:

  • In planta Co-IP to identify physiologically relevant interactions.

  • BiFC or FRET to visualize protein interactions in living cells.

  • Yeast two-hybrid screens to identify potential binding partners.

Each experiment should include appropriate controls and be designed with statistical power in mind.

How can researchers troubleshoot common challenges in ATL66 expression and purification?

Working with membrane-associated proteins like ATL66 presents several challenges:

Challenge: Poor expression in E. coli

  • Solution: Optimize codon usage for E. coli; lower induction temperature (16-18°C); use specialized strains (C41/C43); consider fusion tags that enhance expression (MBP, SUMO).

Challenge: Protein insolubility due to transmembrane domain

  • Solution: Use mild detergents for extraction (CHAPS, DDM); create truncated constructs that exclude the transmembrane domain; employ fusion proteins known to enhance solubility.

Challenge: Protein misfolding

  • Solution: Express in eukaryotic systems (yeast, insect cells); co-express with chaperones; optimize buffer conditions; use molecular chaperones during purification.

Challenge: Low yield of active protein

  • Solution: Scale up culture volume; optimize purification protocol to minimize loss; verify protein activity at each purification step; use affinity tags for efficient capture.

Challenge: Protein degradation during purification

  • Solution: Include protease inhibitors in all buffers; work at 4°C; minimize handling time; add reducing agents to prevent oxidation of cysteine residues in the RING-H2 domain.

Systematic documentation of optimization steps in properly formatted tables will facilitate troubleshooting .

What methods can be used to identify substrates of ATL66 E3 ligase activity?

Identifying physiological substrates is critical for understanding ATL66 function:

In Vitro Ubiquitination Assays:

  • Reconstitute the ubiquitination cascade with purified components (E1, E2, ATL66, ubiquitin, ATP).

  • Test candidate substrates based on phenotypic or interaction data.

  • Detect ubiquitinated species by Western blotting.

Proteomics Approaches:

  • Quantitative proteomics: Compare protein levels in wild-type vs. ATL66 mutant plants to identify accumulated proteins.

  • Ubiquitinome analysis: Enrich for ubiquitinated proteins and compare profiles between wild-type and mutant plants.

  • Proximity labeling: Fuse ATL66 to a biotin ligase (BioID, TurboID) to identify proteins in close proximity.

Genetic Approaches:

  • Suppressor screens of ATL66 overexpression phenotypes.

  • Synthetic lethality/enhancement screens with ATL66 mutants.

  • Genetic interaction mapping to identify functionally related genes.

Stability Assays:

  • Cycloheximide chase experiments to assess protein turnover rates in wild-type vs. ATL66 mutant backgrounds.

  • Cell-free degradation assays using plant extracts.

Potential substrate candidates should be validated through multiple independent approaches.

How can researchers integrate findings from different experimental approaches to build a comprehensive model of ATL66 function?

Integrating diverse experimental data requires systematic approaches:

Multi-omics Data Integration:

  • Combine transcriptomics, proteomics, and phenomics data to create a comprehensive functional model.

  • Use network analysis to place ATL66 in the context of cellular pathways.

  • Apply systems biology approaches to predict emergent properties not evident from individual experiments.

Correlation Analysis:

  • Identify correlations between ATL66 expression patterns and physiological responses.

  • Compare phenotypes across different genetic perturbations of ATL66.

  • Analyze co-expression networks to identify functionally related genes.

Model Building and Testing:

  • Develop testable hypotheses based on integrated data.

  • Design experiments specifically to test model predictions.

  • Refine models iteratively based on new experimental results.

Collaborative Approaches:

  • Establish standardized protocols across research groups to facilitate data comparison.

  • Implement the Collaborative Forum approach to discuss and resolve contradictions.

  • Create shared databases of ATL66-related experimental results.

The integration process should be documented systematically, with contradictions explicitly addressed rather than ignored.

What are the emerging technologies that could advance ATL66 research?

Several cutting-edge technologies offer new possibilities for ATL66 research:

CRISPR-Based Technologies:

  • Base editing for introducing specific mutations without double-strand breaks.

  • Prime editing for precise genetic modifications.

  • CRISPRi/CRISPRa for modulating ATL66 expression without altering the gene sequence.

Single-Cell Techniques:

  • Single-cell RNA-seq to reveal cell type-specific expression patterns.

  • Single-cell proteomics to detect cell-to-cell variation in ATL66 protein levels.

  • Spatial transcriptomics to map expression patterns with tissue context.

Advanced Imaging:

  • Super-resolution microscopy to visualize ATL66 localization with nanometer precision.

  • Live-cell imaging of fluorescently tagged ATL66 to track dynamics in real-time.

  • Correlative light and electron microscopy to link protein localization with ultrastructural context.

Structural Biology Approaches:

  • Cryo-electron microscopy for determining ATL66 structure, potentially in complex with substrates.

  • Hydrogen-deuterium exchange mass spectrometry to map protein interaction surfaces.

  • Integrative structural biology combining multiple techniques for comprehensive structural analysis.

These technologies should be applied with careful experimental design and appropriate controls.

How do findings from ATL66 research contribute to our understanding of plant stress responses and protein degradation pathways?

ATL66 research has broader implications for plant biology:

Contributions to Stress Biology:

  • Identification of protein degradation as a regulatory mechanism in stress responses.

  • Understanding how protein homeostasis is maintained under stress conditions.

  • Revealing crosstalk between different stress signaling pathways through regulated proteolysis.

Advances in Protein Degradation Understanding:

  • Insights into substrate recognition by RING-type E3 ligases.

  • Enhanced understanding of membrane-associated E3 ligases and their regulation.

  • Contributions to the growing map of the plant ubiquitinome.

Evolutionary Perspectives:

  • Understanding how the ATL family expanded and diversified across plant species .

  • Insights into the evolution of protein quality control systems in plants.

  • Comparative analysis of E3 ligase functions across plant lineages.

Potential Applications:

  • Engineering stress tolerance through modification of protein degradation pathways.

  • Development of tools for controlled protein degradation in plants.

  • Identification of targets for crop improvement through breeding or biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.