Recombinant Arabidopsis thaliana RING-H2 finger protein ATL70 (ATL70)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ATL70; At2g35910; F11F19.18; RING-H2 finger protein ATL70; RING-type E3 ubiquitin transferase ATL70
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL70
Target Protein Sequence
MLQFTLSYIKSLTKNLSIISPLPPPKPIKQNHQTKPAMNNFQPPPPSEMPDYNGLLGTDD IGGFRYGIGVSIGVLLLITTITLTSYYCTRNQLSSSPSQTNQDSTRIHHHHHHVIIDVVP GLDEDTIQSYPKILYSEAKGPTTASCCAICLGDYKGKHLLRQLPDCNHLFHLKCIDTWLR LNPTCPVCRTSPLPTPLSTPLAEVVPLASSVAATRMS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G35910

STRING: 3702.AT2G35910.1

UniGene: At.37613

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant ATL70 protein typically expressed and purified?

Recombinant ATL70 is commonly expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The typical methodology involves:

Expression SystemVector TypeTagExpression ConditionsPurification MethodFinal Form
E. colipET or similarN-terminal HisIPTG induction, 16-20°C overnightNi-NTA affinity chromatographyLyophilized powder

Purification protocols typically yield protein with >85-90% purity as determined by SDS-PAGE . For optimal stability, the protein should be:

  • Reconstituted in deionized sterile water to 0.1-1.0 mg/mL

  • Supplemented with 5-50% glycerol (typically 50%)

  • Stored as working aliquots at 4°C for up to one week

  • Long-term stored at -20°C/-80°C with avoidance of repeated freeze-thaw cycles

What experimental approaches are most effective for analyzing ATL70's E3 ligase activity?

To characterize ATL70's function as an E3 ubiquitin ligase, researchers should employ multiple complementary approaches:

In vitro ubiquitination assays:

  • Reconstitute ubiquitination reaction containing:

    • Purified recombinant ATL70-His

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (test a panel of E2s to identify specific partners)

    • Ubiquitin (consider using tagged ubiquitin for easier detection)

    • ATP regeneration system

    • Potential substrate proteins

  • Analyze ubiquitination by:

    • Western blotting for ubiquitin chains

    • Mass spectrometry to identify ubiquitination sites

Mutational analysis:
Modify critical residues in the RING-H2 domain, particularly the zinc-coordinating cysteines and histidines, to confirm their necessity for E3 ligase activity.

Substrate identification techniques:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID)

  • Protein microarrays

When analyzing contradictory results, consider testing ATL70 activity under different stress conditions, as its function may be context-dependent based on findings from related proteins such as ShATL78L .

How can researchers accurately analyze ATL70 expression patterns under different stress conditions?

To thoroughly investigate ATL70 expression patterns under stress conditions, a multi-layered approach is recommended:

Transcriptional analysis:

  • Quantitative RT-PCR with carefully validated reference genes

  • RNA-seq analysis with appropriate time course sampling

  • Promoter-reporter fusion constructs (e.g., ATL70promoter:GUS) to visualize tissue-specific expression

Protein-level analysis:

  • Western blotting with specific antibodies

  • Immunolocalization to determine subcellular localization changes

  • Translational fusions (e.g., ATL70:GFP) under native promoter control

Stress treatment experimental design:
Based on findings with the related ShATL78L protein , the following stress conditions should be tested with appropriate controls:

Stress TypeApplication MethodDurationSampling PointsControls
Cold4°C exposure0-72 hours0, 1, 3, 6, 12, 24, 48, 72h22°C maintained plants
DroughtWithholding water or PEG0-14 daysRegular intervalsWell-watered plants
Salt100-200 mM NaCl0-72 hoursMultiple timepointsStandard media plants
Heat37-42°C exposure0-24 hours0, 0.5, 1, 3, 6, 12, 24h22°C maintained plants
OxidativeH₂O₂ or methyl viologen0-24 hoursMultiple timepointsMock-treated plants
HormonalABA, SA, ETH, IAA0-24 hoursMultiple timepointsSolvent controls

When analyzing potentially contradictory expression data, consider tissue-specific differences, developmental stages, and stress intensity variations that might explain discrepancies .

What methodologies can uncover the regulatory network controlling ATL70 expression?

Understanding the regulatory network governing ATL70 expression requires a comprehensive experimental approach:

Promoter analysis:

  • In silico identification of putative transcription factor binding sites

  • Yeast one-hybrid screening to identify potential transcription factors

  • ChIP assays to confirm binding in vivo

  • Progressive promoter deletions to map regulatory regions

Based on studies of ShATL78L, transcription factors like RAV2 may directly bind to ATL70's promoter . To confirm similar interactions:

  • Clone the ATL70 promoter into a reporter vector (e.g., pHIS2)

  • Co-transform with candidate transcription factors in yeast one-hybrid systems

  • Evaluate binding on selective media with appropriate controls

  • Confirm using electrophoretic mobility shift assays (EMSA)

Epigenetic regulation:

  • DNA methylation analysis through bisulfite sequencing

  • Chromatin immunoprecipitation (ChIP) for histone modifications

  • Analysis in mutants with impaired epigenetic machinery

Post-transcriptional regulation:

  • mRNA stability assays with transcription inhibitors

  • miRNA target prediction and validation

  • RNA-binding protein identification through RNA immunoprecipitation

A systematic approach combining these methods will help resolve seemingly contradictory regulatory data by revealing condition-specific regulatory mechanisms.

How can researchers identify and validate protein-protein interactions of ATL70?

Identifying ATL70's interacting partners is crucial for understanding its function. Based on studies of related proteins, potential interactors may include CSN5B and components of the ubiquitin-proteasome system .

Recommended interaction screening approaches:

MethodStrengthsLimitationsTechnical Considerations
Yeast Two-HybridHigh-throughput, in vivoFalse positives/negativesUse both N- and C-terminal fusions
Co-ImmunoprecipitationPreserves native complexesRequires good antibodiesConsider crosslinking to capture transient interactions
Pull-down assaysDirect biochemical evidenceIn vitro conditionsTest multiple buffer conditions
Bimolecular Fluorescence ComplementationVisualizes interaction locationIrreversible assemblyInclude negative controls
Proximity Labeling (BioID/TurboID)Captures transient/weak interactionsNon-specific labelingOptimize expression levels
FRET/FLIMQuantitative, in vivoTechnical complexityControl for fluorophore orientation

Validation protocol for identified interactions:

  • Confirm by at least two independent methods

  • Map interaction domains through truncation/mutation analysis

  • Test functional relevance through co-expression/co-localization studies

  • Assess biological significance using genetic approaches (e.g., double mutants)

When analyzing ATL70 interactions, focus on proteins involved in abiotic stress responses and the COP9 signalosome complex, as related proteins like ShATL78L have been shown to interact with CSN5B to regulate stress tolerance .

What approaches can resolve contradictions in functional data regarding RING-H2 proteins like ATL70?

When facing contradictory data regarding ATL70 function, consider these methodological approaches:

Systematic phenotypic analysis:

  • Generate multiple independent transgenic lines with varying expression levels

  • Create complementation lines in knockout backgrounds

  • Use inducible expression systems to control timing and level of expression

  • Employ tissue-specific promoters to isolate effects

Comprehensive stress testing protocol:
Contradictory functional data may result from differing experimental conditions. Based on research with ShATL78L , implement a standardized testing regimen:

  • Cold tolerance:

    • Controlled temperature reduction rates

    • Multiple metrics (electrolyte leakage, photosynthetic efficiency, ROS accumulation)

    • Recovery assessment after stress removal

  • Drought tolerance:

    • Both progressive drought and acute osmotic stress

    • Physiological parameters (water loss rate, stomatal conductance)

    • Molecular markers (stress-responsive gene expression)

  • Oxidative stress:

    • Multiple oxidative agents (H₂O₂, methyl viologen, high light)

    • Quantification of oxidative damage markers

    • Antioxidant enzyme activities

Resolving contradictions framework:

  • Standardize experimental conditions across laboratories

  • Consider genetic background effects (ecotype differences)

  • Account for developmental stage and tissue specificity

  • Evaluate stress intensity and duration effects

  • Examine potential functional redundancy with other ATL family members

When faced with contradictions in functional data, systematically evaluate each variable while controlling for others to identify the source of discrepancies.

How can ATL70 research contribute to crop improvement strategies?

ATL70 research has significant potential applications in agricultural biotechnology, particularly for developing stress-resistant crops:

Translational research approaches:

  • Identify orthologous RING-H2 proteins in crop species

  • Engineer enhanced stress tolerance through controlled expression

  • Fine-tune ubiquitination pathways to optimize stress responses

Based on findings with ShATL78L in tomato , engineering strategies might include:

StrategyMethodologyExpected OutcomesPotential Challenges
OverexpressionConstitutive or stress-inducible promotersEnhanced stress tolerancePossible developmental defects
Promoter engineeringModify RAV2 binding sitesFine-tuned stress responseUnpredictable expression patterns
Structure-guided protein engineeringModify key functional domainsEnhanced E3 ligase activityPotential substrate specificity changes
CRISPR-based transcriptional activationdCas9-based systemsControlled endogenous activationOff-target effects

When planning translational research, researchers should account for species-specific differences in ubiquitination pathways and stress response mechanisms to avoid contradictory results between model systems and crops.

What are the most promising techniques for studying the ATL70 interactome comprehensively?

To fully characterize the ATL70 interactome, researchers should implement a multi-faceted approach:

Advanced interactome analysis techniques:

  • Proximity-dependent labeling:

    • BioID or TurboID fusions to identify proteins in close proximity

    • Quantitative proteomics to identify stress-dependent interactions

    • Subcellular compartment-specific analysis

  • Crosslinking mass spectrometry (XL-MS):

    • Captures transient and weak interactions

    • Provides structural information about interaction interfaces

    • Applicable to in vivo conditions

  • Genetic interaction mapping:

    • Synthetic genetic array analysis in yeast models

    • Double mutant analysis in Arabidopsis

    • CRISPR-based approaches for higher-throughput screening

Computational approaches:

  • Protein-protein interaction prediction using machine learning

  • Network analysis to identify functional modules

  • Evolutionary conservation analysis to prioritize core interactions

Based on findings with related proteins, particular attention should be paid to interactions with the COP9 signalosome complex and potential connections to hormone signaling pathways that regulate stress responses .

When encountering contradictory interactome data, researchers should consider context-specific interactions that may only occur under specific stress conditions or in particular tissues/developmental stages.

How can researchers effectively analyze ATL70 substrate specificity and its biological significance?

Understanding the substrate specificity of ATL70 is crucial for elucidating its biological function:

Substrate identification methodologies:

  • Global proteomics approaches:

    • Quantitative proteomics comparing wild-type vs. ATL70 overexpression/knockout

    • Ubiquitinome analysis to identify differentially ubiquitinated proteins

    • Protein stability profiling (e.g., tandem fluorescent timer approaches)

  • Direct biochemical approaches:

    • In vitro ubiquitination assays with candidate substrates

    • Protein microarray screening

    • Phage display for identifying binding motifs

Substrate validation framework:

  • Confirm direct physical interaction

  • Demonstrate ubiquitination in vitro and in vivo

  • Show altered substrate stability in ATL70 mutants

  • Establish biological relevance through genetic approaches

Analyzing the biological significance:

  • Characterize phenotypic effects of preventing substrate ubiquitination

  • Map ubiquitination sites and determine their functional impact

  • Assess how substrate levels change during stress responses

  • Identify substrate-specific effects on plant physiology

When analyzing potentially contradictory substrate data, consider:

  • Conditional substrate specificity that varies with stress conditions

  • Redundancy with other E3 ligases

  • Cell type-specific substrate availability

  • Post-translational modifications that affect recognition

What are the optimal protein expression and purification strategies for functional studies of ATL70?

To obtain high-quality recombinant ATL70 protein for functional studies, researchers should consider these optimized approaches:

Expression system optimization:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coliHigh yield, simple, inexpensiveMay lack PTMs, inclusion body formationIn vitro activity assays, structural studies
Insect cellsBetter folding, some PTMsMore complex, costlierInteraction studies, activity assays
Plant expressionNative PTMs, proper foldingLower yield, time-consumingIn planta functional studies

Purification strategies for maximum activity:

  • For His-tagged ATL70:

    • Use mild elution conditions to preserve structure

    • Include zinc in buffers to maintain RING domain integrity

    • Consider non-denaturing conditions to preserve protein-protein interactions

    • Add reducing agents to prevent oxidation of cysteine residues

  • Quality control assessments:

    • Size-exclusion chromatography to confirm monodispersity

    • Circular dichroism to verify proper folding

    • Activity assays to confirm functional integrity

    • Mass spectrometry to verify protein identity and modifications

Based on available protein specifications , recommended storage conditions include:

  • Storage buffer: Tris/PBS-based buffer, pH 8.0, with 6% trehalose

  • Reconstitution in deionized water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term preservation

How can researchers accurately interpret contradictory findings regarding the role of ATL70 in different stress responses?

When facing contradictory results about ATL70's role in stress responses, implement this systematic approach:

Standardized experimental framework:

  • Define precise stress application protocols with quantifiable parameters

  • Use multiple stress markers and phenotypic readouts

  • Include appropriate genetic controls (null mutants, complementation lines)

  • Employ time-course analyses to capture dynamic responses

Data integration strategies:

  • Meta-analysis of published findings

  • Multi-omics approaches (transcriptomics, proteomics, metabolomics)

  • Network modeling to identify context-dependent effects

  • Comparative analysis across related ATL family members

Sources of contradictions to consider:

  • Genetic background differences between Arabidopsis ecotypes

  • Developmental stage variations

  • Environmental pre-conditioning effects

  • Stress intensity and duration differences

  • Functional redundancy with other ATL proteins

Based on findings with ShATL78L , which shows differential regulation under multiple stresses (cold, drought, salt, heat), researchers should design experiments that systematically evaluate ATL70's function across a spectrum of stress conditions while controlling for confounding variables.

When developing a unified model of ATL70 function, consider its potential role as an integrator of multiple stress signals through targeted ubiquitination of key regulatory proteins.

What methodological considerations are essential when studying RING-H2 domain structure-function relationships?

The RING-H2 domain is critical for ATL70's E3 ligase activity, requiring careful methodological approaches to study its structure-function relationships:

Structural analysis techniques:

  • X-ray crystallography or NMR spectroscopy of isolated RING-H2 domain

  • Homology modeling based on related RING-H2 structures

  • Molecular dynamics simulations to assess zinc coordination and substrate binding

Functional analysis of the RING-H2 domain:

  • Alanine scanning mutagenesis of conserved residues

  • Zinc-binding assays to confirm metal coordination

  • E2 enzyme binding assays to identify specific partners

  • Ubiquitination activity assays with mutant variants

Based on the common features of ATL family RING-H2 domains , particular attention should be paid to:

  • The precise arrangement of 8 zinc-coordinating residues

  • Conserved amino acids between the metal-binding sites

  • Potential substrate recognition surfaces

Technical considerations for experimentation:

  • Include zinc in buffers during purification and assays

  • Use reducing conditions to prevent disulfide formation

  • Consider pH effects on zinc coordination

  • Control metal content using ICP-MS or similar techniques

When analyzing potentially contradictory structure-function data, systematically evaluate how experimental conditions might affect RING-H2 domain integrity and function, particularly with respect to zinc coordination and protein stability.

How can high-throughput approaches advance our understanding of ATL70's role in plant stress responses?

High-throughput technologies offer new opportunities to comprehensively characterize ATL70's function:

Emerging technologies and approaches:

  • CRISPR-based screens:

    • Genome-wide knockout screens to identify genetic interactors

    • CRISPRa/CRISPRi for modulating gene expression

    • Base editing for precise protein engineering

  • Advanced phenotyping platforms:

    • Automated plant phenotyping systems

    • High-resolution imaging of stress responses

    • Real-time physiological measurements

  • Single-cell approaches:

    • Single-cell transcriptomics to identify cell-specific responses

    • Single-cell proteomics for protein-level changes

    • Spatial transcriptomics to map tissue-specific effects

  • Systems biology integration:

    • Multi-omics data integration

    • Machine learning for pattern recognition

    • Network modeling of stress response pathways

Based on studies of related RING-H2 proteins , researchers should focus on:

  • Temporal dynamics of ATL70 response to diverse stresses

  • Cell type-specific functions in stress adaptation

  • Regulatory network interactions with transcription factors like RAV2

  • Integration with hormone signaling pathways

When planning high-throughput experiments, careful experimental design with appropriate controls and validation strategies is essential to avoid contradictory or misleading results.

What are the most promising comparative genomics approaches for understanding ATL70 evolution and function?

Comparative genomics offers valuable insights into ATL70's evolutionary history and functional conservation:

Recommended comparative genomics strategies:

  • Phylogenetic analysis:

    • Comprehensive analysis of ATL family evolution

    • Identification of orthologous proteins in crop species

    • Analysis of selection pressures on ATL70 domains

  • Synteny analysis:

    • Examination of genomic context conservation

    • Identification of co-evolved gene clusters

    • Analysis of regulatory element conservation

  • Functional genomics comparison:

    • Cross-species expression pattern analysis

    • Interactome conservation assessment

    • Complementation studies across species

Based on ATL family studies , researchers should pay particular attention to:

  • Conservation of the RING-H2 domain structure

  • Variability in the hydrophobic regions

  • Presence and conservation of the GLD motif

  • Evolution of stress-responsive regulatory elements

When interpreting comparative genomics data, consider how evolutionary adaptations to different environmental niches might explain functional divergence between ATL70 and its homologs in other species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.