Recombinant Arabidopsis thaliana RING-H2 finger protein ATL72 (ATL72) is a protein within the Arabidopsis Tóxicos en Levadura (ATL) family, which is a subfamily of RING-H2 E3 ubiquitin ligases found in Arabidopsis thaliana . The ATL family consists of 91 members that contain the RING-H2 variation and a hydrophobic domain located at the N-terminal end .
Amino Acid Sequence: MGRLLLEPQANAPANANPKPKGGINDTYFDTNMVIILAALLCALICALSLNSALRCVLRI
TRRFTSDDQVSNASNANANLGRLAAATGLKKQALKQIPVGLYGSGIIDMKATECLICLGD
FEDGEKVRVLPKCNHGFHVRCIDTWLLSRSSCPTCRQSLLLEQPSPMAVSRRDEDMVVSI
V
ATL proteins, including ATL72, contain a RING-H2 domain, a hydrophobic region, and a GLD region . The RING-H2 domain is a variation of the canonical RING finger, characterized by a specific arrangement of 8 zinc ligands . This domain directly binds to the E2 enzyme . The hydrophobic region may function as a transmembrane domain .
The ATL family functions as E3 ubiquitin ligases, mediating plant responses to abiotic stress . Specifically, the ATL protein family targets proteins for degradation via the ubiquitin-proteasome mechanism, acting as a regulator of plant resistance to abiotic stress .
The maize ATL family consists of 77 members, all predicted to be located in the cell membrane and cytoplasm, with a highly conserved RING domain . The expression levels of ATL family genes differ significantly in different tissues, and fluctuate under different stress conditions .
AthATL2 is involved in a defense response, supported by the analysis of A. thaliana mutants that display ectopic expression of AthATL2 as well as from overexpression studies of AthATL2 orthologs . Mutants, named eca (expresión constitutiva de atl2), were selected on the basis of constitutive expression of AthATL2 . In eca mutants, ectopic expression of two early chitin-induced genes, AtMK3 and the zinc finger gene At1g27730, as well as defense related gene such as NPR1, PAL, CHS, PR-1 and PDF2.1, was also triggered, as well as the expression of other ATLs (AthATL6, AthATL12, AthATL13, and AthATL16) .
The proper function of AthATL2 in yeast depends on Ubc4, and together the two proteins target an essential and as yet unknown yeast protein . Ubiquitination assays reported with other ATLs have been shown to rely on the activity of members of the Ubc4/Ubc5 subfamily of E2 conjugases .
Recombinant Arabidopsis thaliana RING-H2 finger protein ATL72 is produced as a recombinant protein .
ATL72 (AT3G10910) is a RING-H2 finger protein from Arabidopsis thaliana that belongs to the ATL family of plant ubiquitin-ligases or E3s. These proteins are components of the ubiquitin proteasome system (UPS) that coordinate the transfer of ubiquitin to target proteins. ATL72 is classified as a single-subunit RING finger E3 that contains both a transmembrane domain and a RING-H2 finger domain .
The protein is also known by alternative names including DAF-Like gene 1 (DAFL1) and is classified as part of the RING/U-box superfamily protein group . As an E3 ubiquitin ligase (EC 2.3.2.27), ATL72 plays a critical role in protein turnover and cellular regulation in plants.
ATL72 exhibits the characteristic domain architecture of the ATL family, which includes:
A transmembrane domain at the amino-terminus (typically 22-24 residues long)
A conserved GLD motif (12-16 amino acids beginning with glycine, leucine, and aspartic acid)
A RING-H2 finger domain containing eight zinc-coordinating residues (six cysteines and two histidines)
The protein does not contain any other recognizable domains beyond these three key features . Like other ATL family members, ATL72 shows selective pressure for conservation of its RING-H2 domain throughout evolution, suggesting functional importance.
Based on the available research, ATL72 is part of a large gene family with diverse expression patterns across plant tissues and developmental stages. While specific expression data for ATL72 is limited in the provided search results, ATL family proteins generally show tissue-specific expression patterns and are often regulated in response to various biotic and abiotic stresses .
Recombinant ATL72 can be produced using several expression systems. Based on current research:
Cell-free expression systems are effective for producing full-length ATL72 protein
E. coli, yeast, baculovirus, and mammalian cell systems can be used for expressing partial ATL72 constructs
When selecting an expression system, researchers should consider:
The presence of transmembrane domains that may complicate expression in prokaryotic systems
Post-translational modifications that may be required for function
The intended application of the recombinant protein (structural studies, enzymatic assays, etc.)
For optimal purity, expressed ATL72 should be purified to ≥85% as determined by SDS-PAGE analysis .
Detection of ATL72 can be accomplished through various techniques:
Western blot analysis using specific antibodies: Polyclonal antibodies raised against ATL72 in rabbit hosts are available and have been validated for Western blot applications
ELISA assays: Anti-ATL72 antibodies can be used in ELISA applications for quantitative detection
SDS-PAGE and Coomassie staining: For recombinant protein analysis and purity assessment
When studying endogenous ATL72 expression, antibody specificity is crucial due to the high sequence similarity among ATL family members.
Assessment of E3 ubiquitin ligase activity for ATL72 requires reconstitution of the ubiquitination cascade:
| Component | Function | Source/Preparation |
|---|---|---|
| E1 enzyme | Ubiquitin activation | Commercial recombinant protein |
| E2 enzyme | Ubiquitin conjugation | Various E2s should be tested for specificity |
| ATL72 (E3) | Ubiquitin ligation | Recombinant preparation (≥85% purity) |
| Ubiquitin | Substrate for transfer | Commercial, consider tagged versions for detection |
| ATP | Energy source | Fresh preparation, typically 2-5 mM |
| Target protein | Substrate for ubiquitination | Candidate substrates must be identified |
The assay should include:
Incubation of all components at physiological temperature (25-30°C for plant proteins)
Analysis by SDS-PAGE and Western blotting to detect ubiquitinated products
Controls lacking individual components to confirm specificity
Time-course analysis to determine reaction kinetics
For researchers new to ubiquitination assays, it's crucial to optimize buffer conditions, as the RING-H2 domain coordinates zinc ions that are essential for structural integrity and catalytic function .
Identifying substrates for E3 ubiquitin ligases like ATL72 remains challenging but several complementary approaches can be employed:
Proximity-based labeling: Using BioID or TurboID fusions with ATL72 to identify proteins in close proximity
Co-immunoprecipitation: Particularly using substrate-trapping mutants (mutations in the RING-H2 domain that prevent substrate release)
Yeast two-hybrid screening: Modified to accommodate the transmembrane domain
Comparative proteomics: Quantitative proteomics comparing wild-type and ATL72 knockout/overexpression lines to identify proteins with altered stability
Any candidate substrates should be validated through:
Direct binding assays with recombinant proteins
In vitro ubiquitination assays
In vivo stability assays comparing wild-type and ATL72 mutant backgrounds
ATL72 belongs to a large family of RING-H2 proteins that are present across plant species. Phylogenetic analysis of the ATL family has revealed:
The ATL family has undergone significant expansion in land plants
The canonical ATL RING-H2 domain shows strong conservation, suggesting functional importance
Phylogenetic trees based on the 42 amino acid sequence of the RING-H2 domain provide better resolution than those based on complete protein sequences
For researchers studying evolutionary relationships, it's important to note that:
The RING-H2 domain and the transmembrane helix co-occur in approximately 82% of proteins containing the canonical ATL RING-H2 domain
This particular domain architecture has been subjected to strong selection during evolution
The carboxy-terminal region following the RING-H2 domain shows the most size variability among ATL family members
When designing functional genomic studies of ATL72, researchers should consider:
Genetic redundancy: The ATL family contains numerous members that may have overlapping functions. Check for close paralogs that might mask phenotypes in single mutants.
Tissue specificity: Design experiments to target tissues where ATL72 is most highly expressed.
Conditional approaches: Consider inducible systems for studying genes that might be essential or have developmental phenotypes.
Knockout validation: Confirm the absence of functional transcript and protein using RT-PCR and Western blotting with specific antibodies .
Off-target effects: For RNAi or CRISPR approaches, carefully design constructs to minimize off-target effects on related ATL family members.
ATL72, like other ATL family members, contains transmembrane domains that anchor it to cellular membranes. To investigate its topology and localization:
Fluorescent protein fusions: Create N- and C-terminal GFP fusions for live-cell imaging, but be cautious as these might interfere with membrane insertion.
Immunolocalization: Use specific antibodies for detection in fixed cells .
Membrane fractionation: Use differential centrifugation and sucrose gradient approaches to determine which cellular membranes contain ATL72.
Protease protection assays: Determine which domains are accessible to externally added proteases in isolated membrane fractions.
Prediction tools: Use computational approaches like TMHMM Server v. 2.0 to predict transmembrane helices , but always validate experimentally.
When analyzing evolutionary patterns of ATL72:
When analyzing ubiquitination assay data:
Quantification methods:
Densitometry of Western blots showing ubiquitinated products
Fluorescence-based assays using labeled ubiquitin
ELISA-based methods for high-throughput analysis
Statistical analysis:
Compare activity across multiple experiments using ANOVA followed by appropriate post-hoc tests
For kinetic data, use non-linear regression to determine reaction parameters
Account for technical variability by using sufficient biological and technical replicates
Visualization:
Plot reaction progress curves showing substrate ubiquitination over time
For substrate specificity studies, present comparative data in tables rather than lists
Recombinant expression of transmembrane proteins like ATL72 presents several challenges:
For researchers working with the transmembrane domain, it's critical to:
Select appropriate detergents for extraction and purification
Consider nanodiscs or liposomes for functional studies
Verify proper folding using circular dichroism or limited proteolysis
When using antibodies against ATL72, specificity is a critical concern due to the similarity among ATL family members. To address this:
Validation in knockout/knockdown systems:
Test antibodies in ATL72 knockout or knockdown lines
Include wild-type controls in all experiments
Blocking peptide controls:
Use the immunizing peptide to confirm specificity in Western blot and immunolocalization
Cross-reactivity testing:
Test against recombinant proteins of closely related ATL family members
Consider epitope mapping to identify unique regions of ATL72
Purification approaches: