Recombinant Arabidopsis thaliana RING-H2 finger protein ATL74 (ATL74)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana RING-H2 Finger Protein ATL74 (ATL74)

Arabidopsis thaliana RING-H2 finger protein ATL74, commonly referred to as ATL74, is a protein encoded by the ATL74 gene (At5g01880) in Arabidopsis thaliana (mouse-ear cress) . ATL74 belongs to the ATL family, which is a large family of RING-H2 finger proteins that function as E3 ubiquitin ligases . Ubiquitin ligases, such as ATL74, play a vital role in the ubiquitin/26S proteasome pathway, which regulates protein degradation in eukaryotic cells . These enzymes facilitate the transfer of ubiquitin to target proteins, thus marking them for degradation and influencing various regulatory processes .

Genomic Organization and Phylogeny

The Arabidopsis thaliana genome contains a large number of genes encoding ubiquitin ligases, with more than 1300 genes predicted to encode these enzymes . Among these, approximately 470 genes encode RING zinc-finger domain proteins, including the ATL family . The ATL family in Arabidopsis thaliana comprises 80 members . Phylogenetic analysis reveals that many rice ATLs are clustered with A. thaliana ATLs, with some gene products showing sequence similarities beyond the conserved features of the ATL family, suggesting potential orthologous relationships .

Functional Studies and Roles in Abiotic Stress Response

RING-H2 finger proteins, including those in the ATL family, have been implicated in various abiotic stress signaling pathways in plants . These proteins can modulate plant hormone responses, such as those involving abscisic acid (ABA), indole-3-acetic acid (IAA), ethylene (ETH), jasmonic acid (JA), and salicylic acid (SA) .

Genetic and Mutant Analysis

Insertional mutagenesis studies involving T-DNA insertions in ATL genes have provided insights into their functions. For example, a T-DNA insertion in ATL43 resulted in an ABA-insensitive phenotype, suggesting a role for this gene in the ABA response .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
ATL74; At5g01880; T20L15_150; RING-H2 finger protein ATL74; RING-type E3 ubiquitin transferase ATL74
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL74
Target Protein Sequence
MHRLLLESHGGGNETSGSGGGDGYTRDMNFDANMVIILAALLCALILALGLNSILRCAMR CGFGLSSSAAAGTVADRAGLKKRELKKFPVAEYGSGEVKIAATECAICLGEFADGERVRV LPPCNHSFHMSCIDTWLVSHSSCPNCRHSLIEVHVAGSE
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G01880

STRING: 3702.AT5G01880.1

UniGene: At.33488

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Arabidopsis thaliana RING-H2 finger protein ATL74?

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL74 (ATL74) is a member of the ATL gene family that encodes RING-H2 finger domain proteins. It functions as a RING-type E3 ubiquitin transferase, playing a crucial role in the ubiquitin/26S proteasome pathway for protein degradation in plants. The full-length protein consists of 159 amino acids and can be produced with an N-terminal His tag in bacterial expression systems such as E. coli for research purposes . The ATL family represents an important class of ubiquitin ligases that participate in substrate specification and mediate the transfer of ubiquitin to target proteins within the cellular proteolytic machinery .

What is the genomic structure of ATL74 and how does it relate to other ATL family members?

ATL74 (At5g01880) belongs to the larger ATL gene family, which comprises 80 members in Arabidopsis thaliana and 121 in Oryza sativa. Like approximately 90% of ATL genes, ATL74 is intronless, suggesting that the structure of basic ATL proteins may have evolved as a functional module . This intronless characteristic is evolutionarily significant as it indicates potential functional conservation and possibly rapid expression capabilities. Comparative genomic analyses show that about 60% of rice ATLs cluster with Arabidopsis ATLs, with many gene products displaying sequence similarities beyond the conserved ATL features, suggesting potential orthologous relationships across species .

What are the optimal conditions for expressing and purifying recombinant ATL74?

For optimal expression and purification of recombinant ATL74, the following protocol has been established based on current research methodologies:

  • Expression System: E. coli bacterial expression system with N-terminal His tag fusion .

  • Purification Method: Affinity chromatography using His-tag binding resins.

  • Storage Conditions:

    • Short-term: Store working aliquots at 4°C for up to one week.

    • Long-term: Store at -20°C/-80°C upon receipt.

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening.

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage .

When working with recombinant ATL74, it's important to note that the protein stability may be affected by buffer conditions. The recommended storage buffer is Tris/PBS-based with 6% Trehalose, pH 8.0 .

How does ATL74 function in the ubiquitin-proteasome pathway?

ATL74 functions as a RING-type E3 ubiquitin transferase in the ubiquitin-proteasome pathway. Based on studies of related ATL family proteins, the mechanism likely involves:

  • Substrate Recognition: The non-RING regions of ATL74 likely recognize specific substrate proteins.

  • E2 Enzyme Interaction: The RING-H2 domain interacts with ubiquitin-conjugating E2 enzymes.

  • Ubiquitin Transfer: ATL74 facilitates the transfer of ubiquitin from E2 to target substrate proteins.

  • Polyubiquitination: Multiple ubiquitin molecules can be attached to target proteins, marking them for degradation by the 26S proteasome .

This process is central to protein turnover and regulation in various cellular processes. Within the Arabidopsis proteome, more than 1300 genes are thought to encode ubiquitin ligases, with approximately 470 containing RING zinc-finger domains, highlighting the diversity and importance of this regulatory mechanism .

What experimental approaches are used to study ATL74 function in planta?

Several experimental approaches can be employed to investigate ATL74 function in planta:

  • T-DNA Insertion Mutants: Generate knockout lines using T-DNA insertions to study loss-of-function phenotypes. Previous surveys of ATL family genes have identified essential members through this approach .

  • Overexpression Studies: Create transgenic plants overexpressing ATL74 to observe gain-of-function phenotypes, similar to studies with other ATL family members like RHA2a .

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) followed by mass spectrometry to identify interacting partners

    • Bimolecular Fluorescence Complementation (BiFC) to validate interactions in vivo

    • Yeast two-hybrid screening to discover potential substrates and regulatory proteins

  • Subcellular Localization:

    • Use fluorescent protein fusions (e.g., ATL74-GFP) for live-cell imaging

    • Conduct organelle fractionation followed by western blotting

  • Transcriptional Profiling:

    • RNA-seq or qRT-PCR to analyze expression patterns under various conditions

    • Compare expression patterns with other family members such as RHA2a

How do ATL family proteins respond to plant stress conditions?

Based on studies of related ATL family proteins, ATL74 likely plays a role in stress responses. For example:

  • Pathogen Response: ATL family members like AtNHR2A and AtNHR2B are induced during pathogen infection (e.g., Pseudomonas syringae), with maximum induction occurring around 6 hours post-inoculation . These proteins contribute to non-host resistance mechanisms.

  • Hormonal Regulation: Some ATL family members, such as RHA2a, are involved in abscisic acid (ABA) signaling, positively regulating ABA-mediated control of seed germination and early seedling development . The evidence for this comes from:

    • Mutant analysis showing altered sensitivity to ABA

    • Gene expression studies revealing patterns similar to known ABA-responsive genes

    • Hypersensitive phenotypes in overexpression lines

  • Developmental Control: ATL family members like ATL8 are primarily expressed in specific developmental stages (e.g., young siliques), suggesting roles in embryogenesis .

ATL Family MemberResponse to StressPhenotype in MutantsReference
RHA2aABA signalingLess sensitive to ABA during germination
AtNHR2A/BPathogen infection (P. syringae)Compromised non-host resistance
ATL43ABA responseABA-insensitive phenotype
ATL8Embryogenesis (not stress)Potentially lethal when knocked out

What protein interaction networks include ATL74?

While specific interaction data for ATL74 is not directly provided in the search results, studies of related ATL family proteins suggest potential interaction networks:

  • Protein Synthesis Machinery: Related ATL proteins like AtNHR2A and AtNHR2B interact with components of the protein synthesis apparatus, including ribosomal proteins and translation factors .

  • Metabolic Enzymes: Interactions with enzymes like AtCCoAOMT1 (caffeoyl-CoA O-methyltransferase) have been documented for ATL family proteins. AtCCoAOMT1 is known to be induced by pathogens, and mutants show increased susceptibility to infections by P. syringae and Hyaloperonospora arabidopsidis .

  • Interactome Validation: Protein interactions can be validated through:

    • Co-immunoprecipitation followed by western blotting

    • Bimolecular Fluorescence Complementation (BiFC) showing interaction in specific subcellular compartments (cytoplasm, punctate bodies)

    • Computational prediction using databases like STRING

When investigating ATL74's interaction network, approximately 40% of experimentally identified interactions for related ATL proteins were also predicted by computational approaches, suggesting that many of these interactions are genuine and functionally significant .

What techniques are recommended for studying ATL74's E3 ligase activity?

To study ATL74's E3 ubiquitin ligase activity, the following methods are recommended:

  • In Vitro Ubiquitination Assays:

    • Purify recombinant ATL74 with appropriate tags (His-tag)

    • Include E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), ubiquitin (often tagged with FLAG or HA), ATP, and potential substrates

    • Detect ubiquitination through western blotting

  • Mutagenesis Studies:

    • Create mutations in conserved residues of the RING-H2 domain that coordinate zinc ions

    • Test the effect of these mutations on E3 ligase activity

    • Compare with wild-type protein to identify critical residues for catalytic function

  • Substrate Identification:

    • Use protein arrays or mass spectrometry-based approaches

    • Perform yeast two-hybrid screens to identify interacting proteins

    • Validate in planta using co-immunoprecipitation and genetic analysis

The RING-H2 domain is essential for E3 ligase activity, as demonstrated with related proteins like RHA2a, where this domain is critical for its biological function in ABA signaling .

How can cell wall organization studies enhance understanding of ATL74 function?

Recent research on Arabidopsis cell wall organization provides methodological approaches that could be applied to understand ATL74 function, particularly if it's involved in developmental processes:

  • Nanoindentation Experiments:

    • Conduct measurements in three orthogonal directions (normal and two lateral) to capture 3D anisotropic mechanical properties

    • Apply to various tissues where ATL74 is expressed

    • Compare wild-type with atl74 mutants to identify phenotypic differences

  • Confocal Microscopy:

    • Use laser scanning confocal microscopy to capture accurate cell geometries

    • Generate computational models based on experimental data

    • Analyze cell morphology in response to various treatments

  • Genetic Approaches:

    • Analyze atl74 mutants alongside other cell wall organization mutants

    • Create double mutants to study genetic interactions

    • Compare cellulose and pectin components in wild-type versus mutant plants

Such approaches could reveal potential roles of ATL74 in cell wall organization or modification, particularly if it regulates the degradation of proteins involved in these processes.

What are the key knowledge gaps in ATL74 research?

Several important knowledge gaps exist in our understanding of ATL74:

  • Substrate Specificity: The specific proteins targeted by ATL74 for ubiquitination remain largely unknown. Identifying these substrates is crucial for understanding its biological function.

  • Regulation Mechanisms: How ATL74 activity is itself regulated (through post-translational modifications, protein-protein interactions, or transcriptional control) requires further investigation.

  • Functional Redundancy: The degree of functional overlap with other ATL family members needs clarification to understand the consequences of its manipulation.

  • Physiological Roles: The specific biological processes and stress responses in which ATL74 participates remain to be fully elucidated, though insights from other ATL proteins suggest potential roles in pathogen response and hormone signaling .

  • Structural Determinants: Detailed structure-function relationships, particularly regarding substrate recognition domains outside the RING-H2 motif, represent an important area for future research.

What emerging technologies could advance ATL74 research?

Several cutting-edge technologies offer promising avenues for advancing ATL74 research:

  • CRISPR-Cas9 Gene Editing:

    • Create precise mutations in ATL74 to study function

    • Generate knockin reporter lines for real-time visualization

    • Create conditional knockout systems for tissue-specific studies

  • Proximity-Dependent Labeling:

    • Use BioID or TurboID fusions to identify proteins in close proximity to ATL74

    • Map spatial interactomes in different subcellular compartments

    • Identify transient interactions that might be missed by traditional co-IP

  • Cryo-EM and AlphaFold2:

    • Determine high-resolution structures of ATL74 alone and in complex with substrates

    • Use predicted protein structures to guide functional studies

    • Model interactions with E2 enzymes and substrates

  • Single-Cell Technologies:

    • Apply single-cell transcriptomics to understand cell-specific expression patterns

    • Use single-cell proteomics to track ATL74 abundance in different cell types

    • Correlate with cellular phenotypes during development and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.