Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL78; At1g49230; F27J15.2; RING-H2 finger protein ATL78; RING-type E3 ubiquitin transferase ATL78
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Protein Sequence
MCTTISISISTIKPTEIFQEILGSSYSRKLLFHTHDQSPTPAPSPYVGDNNFDANVVMVL
SVLLCALVCSLGLNSIIRCALRCSNLVPSEAGGDNYPVRLTNTGVKRKALKSFQTVSYST
ELNLPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCRHCLIQTC
EKIADCSQTSSLNSTQPPQDSIILQIAPLEPERWIRWFR