Recombinant Arabidopsis thaliana RING-H2 finger protein ATL79 (ATL79)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ATL79; At5g47610; MNJ7.20; RING-H2 finger protein ATL79; RING-type E3 ubiquitin transferase ATL79
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-166
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL79
Target Protein Sequence
TPTCNSHTCRWKPYSNSTDFTANASVLLILVISALICALSLYAAIRCFLRPTLETEDDHK PDPEAAASSTPTTPTLVYSSDLELAGAEAECAICLSEFEQGESIQVLEKCQHGFHVKCIH KWLSTRSSCPTCRTSIFSQHSETPSSHINA
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G47610

STRING: 3702.AT5G47610.1

UniGene: At.29885

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL79 and what is its functional role in Arabidopsis thaliana?

ATL79 (UniProt ID: Q9FGJ6) is a RING-H2 finger protein that belongs to the ATL family of E3 ubiquitin ligases in Arabidopsis thaliana. It is a 166-amino acid protein with a highly conserved RING-H2 domain that binds zinc ions and functions in the ubiquitin-proteasome system (UPS) .

The ATL family, to which ATL79 belongs, contains a transmembrane domain and a RING-H2 finger domain without other previously described domains. These proteins are involved in various physiological processes including hormone signaling, development, and response to biotic and abiotic stresses .

While the specific targets of ATL79 have not been fully characterized, research on other ATL family members suggests it likely functions as an E3 ubiquitin ligase that mediates the transfer of ubiquitin to target proteins, marking them for degradation by the 26S proteasome. Similar ATL proteins have been shown to modulate various physiological processes and stress responses in Arabidopsis .

Analysis methodology: To determine the function of ATL79, researchers typically employ a combination of approaches, including:

  • Expression analysis in different tissues and under various stress conditions

  • Phenotypic characterization of knockout/overexpression lines

  • Protein-protein interaction studies to identify potential targets

  • Ubiquitination assays to confirm E3 ligase activity

What are the structural characteristics of the RING-H2 domain in ATL proteins?

The RING-H2 domain in ATL proteins, including ATL79, possesses several key structural features:

  • It contains eight conserved metal ligands (six cysteines and two histidines) that coordinate two zinc ions in a cross-brace structure .

  • The spacing between these zinc ligands is highly conserved within the ATL family.

  • A tryptophan residue is invariably positioned three residues downstream from the sixth zinc ligand .

  • Additional conserved amino acid residues include:

    • A leucine following the second metal ligand

    • A phenylalanine preceding the fifth ligand

    • A proline next to the seventh ligand

The RING-H2 domain is crucial for the E3 ligase function as it binds to E2 ubiquitin-conjugating enzymes. The three-dimensional structure, as determined by NMR spectroscopy for the rice ATL protein EL5, demonstrates structural features similar to previously characterized RING domains .

Research approach: Structural characterization typically involves:

  • Sequence alignment of ATL RING-H2 domains to identify conserved residues

  • Mutational analysis of key amino acids to determine their role in E2 binding

  • Protein structure determination using NMR spectroscopy or X-ray crystallography

  • Interaction studies between the RING-H2 domain and E2 conjugating enzymes

How is recombinant ATL79 produced for research purposes?

Recombinant ATL79 is typically produced through heterologous expression in E. coli. The specific methodology includes:

  • Gene cloning: The ATL79 coding sequence (for mature protein, amino acids 17-166) is cloned into an expression vector with an N-terminal His-tag .

  • Expression system: The construct is transformed into E. coli expression strains optimized for recombinant protein production.

  • Protein expression: Bacterial cultures are induced to express the recombinant protein, typically using IPTG for systems with T7 or lac promoters.

  • Purification protocol:

    • Bacterial cells are lysed to release the recombinant protein

    • The His-tagged protein is purified using Ni-NTA affinity chromatography

    • Further purification steps may include ion exchange chromatography or size exclusion chromatography

  • Quality control:

    • SDS-PAGE analysis to assess purity (>90% purity is typically achieved)

    • Western blot analysis with anti-His antibodies to confirm identity

    • Mass spectrometry for precise molecular weight determination

  • Storage: The purified protein is commonly lyophilized or stored in buffer with 50% glycerol at -20°C/-80°C .

The resulting recombinant protein is suitable for various applications including enzymatic assays, interaction studies, and antibody production.

What experimental design should be used to identify the E2 enzyme partners of ATL79?

Identifying the E2 enzyme partners of ATL79 requires a systematic experimental approach:

  • Yeast two-hybrid (Y2H) screening:

    • Use the RING-H2 domain of ATL79 as bait

    • Screen against a library of E2 ubiquitin-conjugating enzymes from Arabidopsis

    • Confirm positive interactions through secondary screens

  • In vitro protein-protein interaction assays:

    • Pull-down assays using purified recombinant ATL79 and candidate E2 enzymes

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) to measure binding affinities

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of ATL79 and E2 candidates in plant protoplasts

    • Immunoprecipitate ATL79 and analyze for co-precipitation of E2 enzymes

    • Perform the reciprocal experiment (immunoprecipitate E2 and check for ATL79)

  • In vitro ubiquitination assays:

    • Set up reactions containing E1, various E2 candidates, recombinant ATL79, ubiquitin, and ATP

    • Assess ubiquitination activity via Western blot analysis

    • Compare efficiency across different E2 enzymes

Based on studies of other ATL proteins, members of the Ubc4/Ubc5 subfamily of E2 conjugases would be primary candidates for partners of ATL79 .

Experimental design considerations:

  • Include positive controls (known E2-E3 pairs) and negative controls (E2s without RING domain or with mutated RING domain)

  • Use a completely randomized design (CRD) for in vitro assays to minimize experimental bias

  • For protoplast experiments, consider a randomized block design (RBD) where each transfection round serves as a block

How can I validate the subcellular localization of ATL79 in plant cells?

Validating the subcellular localization of ATL79 requires a multi-method approach:

  • Bioinformatic prediction:

    • Analyze the protein sequence using tools like PSORT, TargetP, and TMHMM

    • Identify potential transmembrane domains, signal peptides, and targeting sequences

    • Most ATL family members are predicted to be located in the cell membrane and cytoplasm due to their transmembrane domains

  • Fluorescent protein fusion experiments:

    • Create N- and C-terminal GFP/YFP fusions of ATL79

    • Express in Arabidopsis protoplasts or tobacco leaf epidermal cells via Agrobacterium-mediated transformation

    • Visualize using confocal laser scanning microscopy

  • Co-localization studies:

    • Use established organelle markers (e.g., mCherry-tagged markers for ER, Golgi, plasma membrane)

    • Perform simultaneous imaging with the ATL79-GFP fusion

    • Calculate co-localization coefficients (Pearson's or Mander's)

  • Subcellular fractionation and Western blotting:

    • Extract proteins from different cellular compartments

    • Detect ATL79 using specific antibodies

    • Compare with marker proteins for different organelles

  • Immunogold electron microscopy:

    • Fix plant tissues and perform ultrathin sectioning

    • Label with anti-ATL79 antibodies and gold-conjugated secondary antibodies

    • Visualize using transmission electron microscopy for precise localization

Data analysis approach:

  • For fluorescence imaging: Perform quantitative analysis of co-localization using software like ImageJ with JACoP plugin

  • For fractionation: Compare enrichment of ATL79 across different cellular fractions relative to marker proteins

  • Statistical analysis: Use ANOVA to determine significant differences in protein distribution among cellular compartments

What methodologies are most effective for elucidating the specific targets of ATL79-mediated ubiquitination?

Identifying the specific targets of ATL79-mediated ubiquitination requires a comprehensive strategy combining multiple approaches:

  • Proximity-dependent biotin identification (BioID):

    • Fuse ATL79 to a promiscuous biotin ligase (BirA*)

    • Express the fusion protein in Arabidopsis

    • Identify biotinylated proteins (potential interactors/substrates) by streptavidin pull-down and mass spectrometry

  • Tandem ubiquitin binding entities (TUBEs):

    • Use TUBEs to enrich for ubiquitinated proteins from wild-type and ATL79 overexpression/knockout lines

    • Compare ubiquitination profiles using quantitative proteomics

    • Identify proteins with altered ubiquitination status

  • Yeast two-hybrid screening with substrate specificity determinants:

    • Use domains of ATL79 other than the RING-H2 domain as bait

    • Screen an Arabidopsis cDNA library

    • Validate interactions with candidate substrates through independent methods

  • Co-immunoprecipitation coupled with ubiquitination assays:

    • Immunoprecipitate ATL79 from plant tissues

    • Identify co-precipitating proteins by mass spectrometry

    • Test candidate substrates in in vitro ubiquitination assays

  • Comparative proteomics of ATL79 mutants:

    • Compare protein levels in ATL79 overexpression, knockout, and wild-type plants

    • Identify proteins that accumulate in knockout lines or decrease in overexpression lines

    • Confirm direct ubiquitination of candidate targets

  • In vivo ubiquitination assays with candidate substrates:

    • Co-express ATL79 and candidate substrates in protoplasts

    • Immunoprecipitate the substrate and analyze ubiquitination status

    • Compare with controls lacking ATL79 or using a catalytically inactive ATL79 mutant

Experimental design consideration:
For comparative proteomics and in vivo assays, a Latin Square Design (LSD) can be effective as it controls for multiple variables simultaneously (e.g., genotype, treatment conditions, and time points) .

Data analysis methodology:

  • For proteomics data: Use tools like MaxQuant and Perseus for identification and quantification

  • Statistical analysis: Apply multiple testing correction methods (e.g., Benjamini-Hochberg) to control false discovery rate

  • Network analysis: Integrate results with protein interaction databases to identify functional clusters

How can I investigate the role of ATL79 in plant stress responses?

Investigating the role of ATL79 in plant stress responses requires a systematic approach:

  • Expression analysis under stress conditions:

    • Perform qRT-PCR, RNA-seq, or microarray analysis of ATL79 expression

    • Apply various stresses (drought, salt, heat, cold, pathogen infection)

    • Include time-course analysis to capture transient expression changes

    • Similar to other ATL genes, ATL79 may show rapid and transient induction by PAMPs or other stress signals

  • Generation and phenotypic characterization of transgenic lines:

    • Create ATL79 knockout/knockdown lines using T-DNA insertion or CRISPR/Cas9

    • Develop ATL79 overexpression lines under constitutive or inducible promoters

    • Evaluate phenotypes under normal and stress conditions:

      • Growth parameters (height, biomass, root development)

      • Physiological parameters (photosynthetic efficiency, water use efficiency)

      • Biochemical parameters (ROS levels, stress hormone content)

  • Stress tolerance assays:

    • Subject transgenic and wild-type plants to controlled stress conditions

    • Design experiments with appropriate controls and replication

    • Measure survival rates, recovery after stress, and growth parameters

    • Similar ATL family members have shown enhanced resistance to high-temperature stress when overexpressed

  • Molecular response analysis:

    • Analyze expression of stress-responsive marker genes in ATL79 transgenic lines

    • Investigate post-translational modifications of stress-related proteins

    • Measure levels of stress hormones (ABA, ethylene, jasmonate, salicylic acid)

  • Comparative analysis with other ATL family members:

    • Compare stress response phenotypes with those of other ATL gene mutants

    • Investigate potential functional redundancy through double/triple mutants

    • Perform complementation studies across different ATL mutants

Experimental design considerations:

  • For stress experiments, use a randomized complete block design (RBD) with each experimental batch as a block to control for environmental variations

  • Include time-course studies to capture both immediate and long-term responses

  • Analyze multiple independent transgenic lines to control for position effects

Data analysis approach:

  • For stress tolerance data: Apply survival analysis methods (e.g., Kaplan-Meier curves)

  • For expression data: Use differential expression analysis with appropriate normalization

  • For multiple stress comparisons: Employ multivariate analysis techniques (PCA, clustering)

What approach should be used to investigate the structural determinants of ATL79 substrate specificity?

Investigating the structural determinants of ATL79 substrate specificity requires a combination of structural biology, molecular biology, and biochemical approaches:

  • Structural analysis of ATL79:

    • Determine the three-dimensional structure of ATL79 using:

      • X-ray crystallography (challenging due to transmembrane domain)

      • NMR spectroscopy for soluble domains

      • Cryo-electron microscopy for full-length protein

    • Compare with known structures of other RING-H2 proteins

    • Identify potential substrate-binding surfaces

  • Domain deletion and chimeric protein analysis:

    • Create truncated versions of ATL79 lacking specific domains

    • Generate chimeric proteins by swapping domains between ATL79 and other ATL family members

    • Test these constructs for substrate recognition in ubiquitination assays

    • The GLD motif, a conserved region in ATL proteins, may play a role in substrate specificity

  • Alanine scanning mutagenesis:

    • Systematically replace conserved amino acids with alanine

    • Focus on residues outside the RING-H2 domain that may interact with substrates

    • Test mutants for altered substrate specificity or binding affinity

  • Molecular docking and simulation:

    • Perform in silico docking of candidate substrates to the ATL79 structure

    • Run molecular dynamics simulations to assess stability of interactions

    • Identify key residues at the interaction interface

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map protein-protein interaction surfaces between ATL79 and its substrates

    • Identify regions with altered deuterium uptake upon substrate binding

    • Confirm the importance of these regions through targeted mutagenesis

  • Peptide array analysis:

    • Screen peptide libraries derived from potential substrates

    • Identify sequence motifs recognized by ATL79

    • Validate these motifs through mutagenesis of substrates

Experimental validation:

  • For each approach, include multiple biological replicates (n≥3)

  • Use appropriate statistical methods to assess significance of observed differences

  • Validate key findings through orthogonal methods

Data integration methodology:

  • Combine results from multiple approaches to build a comprehensive model

  • Use structure-based sequence alignments to compare with other ATL proteins

  • Apply machine learning algorithms to predict additional substrates based on identified motifs

How can I design experiments to investigate the role of post-translational modifications in regulating ATL79 activity?

Investigating post-translational modifications (PTMs) of ATL79 requires a comprehensive experimental approach:

  • Identification of potential PTMs:

    • Perform mass spectrometry analysis of purified ATL79 from plant tissues

    • Use enrichment methods for specific PTMs:

      • Phosphopeptide enrichment (TiO2, IMAC)

      • Ubiquitin remnant profiling

      • Redox proteomics for cysteine modifications

    • Compare PTM profiles under normal and stress conditions

  • Site-directed mutagenesis of modified residues:

    • Create phospho-mimetic mutants (Ser/Thr/Tyr to Asp/Glu)

    • Create phospho-null mutants (Ser/Thr/Tyr to Ala)

    • Generate Lys to Arg mutations to prevent ubiquitination

    • Create Cys to Ser mutations to prevent redox modifications

  • Functional analysis of PTM mutants:

    • Compare E3 ligase activity of wild-type and mutant ATL79 in vitro

    • Assess protein stability, subcellular localization, and protein-protein interactions

    • Perform complementation studies in atl79 knockout plants

    • The activity of RING-H2 E3 ligases can be regulated by various PTMs that affect their stability, localization, or interaction with E2 enzymes

  • Identification of regulatory enzymes:

    • Use inhibitors of specific kinases, phosphatases, or deubiquitinating enzymes

    • Perform genetic screens to identify modifiers of ATL79 activity

    • Conduct co-immunoprecipitation experiments to identify interacting regulatory proteins

  • Temporal dynamics of PTMs:

    • Analyze PTM patterns at different time points after stress application

    • Correlate changes in PTMs with alterations in ATL79 activity

    • Use pulse-chase experiments to determine the stability of modified ATL79

Experimental design table for PTM analysis:

ExperimentPurposeControlsAnalysis Method
MS/MS analysisIdentify PTMsUnmodified recombinant ATL79Database search with PTM options
Phosphorylation mappingLocate phosphositesλ-phosphatase treated samplePhosphopeptide enrichment + MS
Ubiquitination assay of PTM mutantsAssess functional impactWild-type ATL79Quantitative Western blot
In vivo complementationValidate biological significanceWT complementation, empty vectorPhenotypic assessment
PTM dynamicsDetermine temporal regulationUntreated samplesTime-course MS analysis

Data analysis approach:

  • For MS data: Use specialized PTM search algorithms (e.g., MaxQuant, Mascot)

  • For functional assays: Apply ANOVA with appropriate post-hoc tests

  • For time-course data: Consider time-series analysis methods

What approaches can be used to investigate the evolutionary conservation and divergence of ATL79 function across plant species?

Investigating the evolutionary conservation and divergence of ATL79 function requires a comprehensive comparative genomics and functional validation approach:

  • Phylogenetic analysis of ATL family across plant species:

    • Identify ATL79 homologs in diverse plant genomes using reciprocal BLAST searches

    • Perform multiple sequence alignments to identify conserved and divergent regions

    • Construct phylogenetic trees to establish evolutionary relationships

    • The ATL family is diverse, with numerous members showing varying degrees of conservation across species

  • Comparative genomic analysis:

    • Analyze synteny and gene order conservation around ATL79 orthologs

    • Examine intron-exon structures for evolutionary changes

    • Identify conserved cis-regulatory elements in promoter regions

    • Compare rates of synonymous vs. non-synonymous substitutions (dN/dS) to detect signatures of selection

  • Domain architecture analysis:

    • Compare the structure and organization of functional domains (RING-H2, transmembrane, GLD motif)

    • Identify lineage-specific additions, deletions, or modifications

    • Map these changes onto the phylogenetic tree to understand evolutionary trajectories

    • The ATL RING-H2 domain has a precise disposition of zinc ligands and other conserved residues that can be compared across species

  • Heterologous complementation studies:

    • Express ATL79 orthologs from different species in Arabidopsis atl79 mutants

    • Assess functional complementation under normal and stress conditions

    • Identify functionally conserved vs. species-specific activities

  • Cross-species protein-protein interaction studies:

    • Test interaction of ATL79 orthologs with E2 enzymes from different species

    • Investigate substrate recognition across species boundaries

    • Use yeast two-hybrid or in vitro binding assays for cross-species comparisons

  • Transcriptional response conservation:

    • Compare expression patterns of ATL79 orthologs under similar conditions

    • Identify conserved and divergent stress responses

    • Similar ATL genes in different species show varied expression patterns under stress conditions

Experimental design considerations:

  • For comparative functional studies, use a completely randomized design with multiple biological replicates

  • Include appropriate phylogenetic controls (closely and distantly related orthologs)

  • Ensure consistent experimental conditions across species comparisons

Data analysis methodology:

  • For sequence analysis: Apply specialized evolutionary models (e.g., PAL2NAL, PAML)

  • For functional data: Use mixed-effect models to account for species-specific variation

  • For multiple comparisons: Apply family-wise error correction methods

  • Integration: Use statistical approaches like PGLS (Phylogenetic Generalized Least Squares) to account for phylogenetic non-independence

What are the critical quality control parameters for recombinant ATL79 protein preparation?

Ensuring high-quality recombinant ATL79 protein is crucial for reliable experimental outcomes. The following quality control parameters should be systematically evaluated:

  • Purity assessment:

    • SDS-PAGE analysis: Should show >90% purity with a single predominant band at the expected molecular weight (~19 kDa for His-tagged ATL79)

    • Densitometry analysis of the gel to quantify purity percentage

    • High-performance liquid chromatography (HPLC) to detect impurities

  • Identity confirmation:

    • Western blot analysis using anti-His antibodies or ATL79-specific antibodies

    • Mass spectrometry:

      • Peptide mass fingerprinting

      • Sequence coverage analysis (aim for >80% coverage)

      • Accurate mass determination (<10 ppm error)

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assay to determine protein stability

    • Dynamic light scattering (DLS) to check for aggregation

    • For RING-H2 proteins, zinc content analysis is critical as it affects structural integrity

  • Functional verification:

    • In vitro ubiquitination assay with E1, E2, and ubiquitin

    • E2 binding assay to confirm interaction with cognate E2 enzymes

    • ATL proteins should demonstrate E3 ligase activity in the presence of appropriate E2 enzymes

  • Storage stability:

    • Freeze-thaw stability tests (activity after multiple freeze-thaw cycles)

    • Long-term storage tests at different temperatures (-20°C, -80°C)

    • Effect of lyophilization on protein activity

Quality control data table example:

ParameterMethodAcceptance CriteriaResult
PuritySDS-PAGE>90%95%
IdentityMS>80% sequence coverage87% coverage
MW accuracyMS<5% deviation from calculated MW19.2 kDa (expected: 19.0 kDa)
Zinc contentICP-MS2 mol Zn/mol protein1.9 mol Zn/mol protein
E3 activityUbiquitination assay>50% of reference standard85% of standard
AggregationDLS<10% high MW species5% aggregates

Experimental design considerations:

  • Perform all QC tests on at least three independent protein preparations

  • Include appropriate positive and negative controls

  • Use statistical methods to establish acceptance criteria and specifications

How should experimental designs be optimized when studying ATL79 interactions with E2 enzymes and substrates?

Optimizing experimental designs for studying ATL79 interactions with E2 enzymes and substrates requires careful consideration of multiple factors:

  • Selection of appropriate experimental system:

    • In vitro systems using purified components

    • Cell-free expression systems

    • Heterologous expression in yeast

    • Plant protoplast transient expression

    • Stable transgenic Arabidopsis lines

    • Each system has different strengths for studying specific aspects of interactions

  • Protein expression and tagging strategies:

    • Use small tags (His, FLAG) to minimize interference with protein function

    • Consider tag position (N- vs. C-terminal) based on domain organization

    • For ATL79, the N-terminus contains a transmembrane domain, so C-terminal tagging may be preferable

    • Test multiple constructs in parallel to identify optimal configuration

  • Interaction assay selection:

    • For qualitative binary interactions: Yeast two-hybrid, pull-down assays

    • For kinetic/affinity measurements: Surface plasmon resonance, isothermal titration calorimetry

    • For in vivo validation: Co-immunoprecipitation, FRET/BRET, BiFC

    • For network-level analysis: Proximity labeling (BioID, APEX)

  • Controls and validation:

    • Positive controls: Known E2-E3 pairs (e.g., AtUBC8 with other ATL proteins)

    • Negative controls:

      • Catalytically inactive ATL79 mutant (mutations in RING-H2 domain)

      • Unrelated E2 enzymes from different subfamilies

      • E2 binding-deficient mutants based on structure-guided design

  • Experimental design structure:

    • For screening multiple E2s: Use a completely randomized design (CRD)

    • For comparing wild-type vs. mutant interactions: Use a randomized block design (RBD)

    • For multi-factorial experiments (E2 type × substrate × condition): Consider Latin square design (LSD)

  • Statistical power considerations:

    • Conduct power analysis to determine appropriate sample size

    • Use at least three biological replicates for each experimental condition

    • Include technical replicates to assess measurement variability

Decision matrix for interaction assay selection:

Research QuestionRecommended Primary AssayValidation MethodControls
E2 partner identificationY2H screenPull-down assayKnown E2-ATL pairs
Binding affinitySPRITCBinding-deficient mutant
In vivo interactionCo-IPBiFCNon-interacting proteins
Substrate identificationAP-MSIn vitro ubiquitinationCatalytically inactive ATL79
Domain mappingDeletion analysis in Y2HDomain swappingHighly divergent ATL

Data analysis approach:

  • For interaction screens: Apply appropriate statistical threshold with multiple testing correction

  • For quantitative measurements: Use curve fitting and statistical comparisons of binding parameters

  • For complex designs: Apply ANOVA with appropriate post-hoc tests and effect size calculations

What are the best approaches for analyzing ATL79 gene expression and regulation in different tissues and under various stress conditions?

Comprehensive analysis of ATL79 gene expression and regulation requires multiple complementary approaches:

  • Transcriptional profiling methods:

    • Quantitative RT-PCR (RT-qPCR):

      • Select stable reference genes for normalization (validated for the specific conditions)

      • Design intron-spanning primers specific to ATL79

      • Use technical triplicates and biological replicates (n≥3)

    • RNA-seq analysis:

      • Generate tissue-specific and stress-responsive transcriptomes

      • Use sufficient sequencing depth (>20 million reads per sample)

      • Apply appropriate normalization methods (TPM, FPKM, or DESeq2/edgeR)

      • Similar ATL family genes show tissue-specific expression patterns

    • Microarray analysis:

      • Useful for comparing with legacy data

      • Ensure proper probe design and annotation for ATL79

  • Promoter analysis and transcriptional regulation:

    • In silico analysis:

      • Identify conserved cis-regulatory elements in the ATL79 promoter

      • Compare with promoters of co-regulated genes

      • Use tools like PLACE, PlantCARE, or JASPAR databases

    • Reporter gene assays:

      • Create promoter-reporter fusions (e.g., ATL79pro:GUS, ATL79pro:LUC)

      • Test in stable transgenic plants or transient expression systems

      • Analyze reporter activity in different tissues and stress conditions

    • Chromatin immunoprecipitation (ChIP):

      • Identify transcription factors binding to the ATL79 promoter

      • Use tagged TFs or TF-specific antibodies

      • Combine with sequencing (ChIP-seq) for genome-wide binding profiles

  • Tissue-specific expression analysis:

    • Histochemical analysis:

      • Use promoter-reporter fusions (ATL79pro:GUS)

      • Perform tissue sections and microscopic analysis

    • RNA in situ hybridization:

      • Design probes specific to ATL79 mRNA

      • Perform on tissue sections for cellular resolution

    • Single-cell RNA-seq:

      • Isolate specific cell types using FACS or microdissection

      • Generate cell type-specific expression profiles

  • Stress-responsive expression dynamics:

    • Time-course experiments:

      • Sample at multiple time points after stress application

      • Include very early time points (15 min, 30 min, 1 h)

      • Other ATL genes show rapid and transient induction by stress signals

    • Dose-response analysis:

      • Apply stress treatments at different intensities

      • Determine expression thresholds for activation

Experimental design example for stress-responsive expression:

Time Point (h)ControlHeat StressDroughtSaltPathogen
03 reps3 reps3 reps3 reps3 reps
0.253 reps3 reps3 reps3 reps3 reps
0.53 reps3 reps3 reps3 reps3 reps
13 reps3 reps3 reps3 reps3 reps
33 reps3 reps3 reps3 reps3 reps
63 reps3 reps3 reps3 reps3 reps
243 reps3 reps3 reps3 reps3 reps

Data analysis methodology:

  • For RT-qPCR: Use the 2^(-ΔΔCT) method with appropriate statistical testing

  • For RNA-seq: Apply DESeq2 or edgeR for differential expression analysis

  • For time-course data: Consider specialized methods like STEM or maSigPro

  • For multiple stress comparisons: Use multivariate approaches (PCA, clustering) to identify common and specific responses

How can CRISPR/Cas9 technology be effectively used to investigate ATL79 function in Arabidopsis?

CRISPR/Cas9 technology offers powerful approaches to investigate ATL79 function through precise genome editing:

  • Gene knockout strategies:

    • Complete gene deletion:

      • Design sgRNAs targeting sequences flanking the ATL79 gene

      • Screen for large deletions removing the entire coding sequence

    • Frameshift mutations:

      • Design sgRNAs targeting early exons

      • Screen for indels causing frameshifts and premature stop codons

      • Target the RING-H2 domain for functional disruption

    • Domain-specific editing:

      • Precisely target functional domains (RING-H2, GLD motif)

      • Create in-frame deletions or specific amino acid changes

  • Base editing and prime editing approaches:

    • Use cytosine or adenine base editors to introduce point mutations

    • Create catalytically inactive variants (e.g., convert zinc-coordinating Cys/His to Ser/Arg)

    • Modify key residues involved in E2 binding identified from other ATL proteins

    • Use prime editing for precise sequence replacements without DSBs

  • Promoter editing:

    • Modify cis-regulatory elements in the ATL79 promoter

    • Create variants with altered expression patterns or stress responsiveness

    • Replace native promoter with inducible or tissue-specific promoters

  • Tagging strategies:

    • Insert epitope tags or fluorescent proteins in-frame

    • Create C-terminal fusions to avoid disrupting the N-terminal transmembrane domain

    • Develop endogenously tagged lines for physiologically relevant expression levels

  • Multiplexed editing:

    • Target multiple ATL family members simultaneously to address functional redundancy

    • Create higher-order mutants of related ATL genes

    • The maize ATL family consists of 77 members, suggesting possible redundancy in Arabidopsis as well

Experimental design considerations:

  • Design multiple sgRNAs for each target using tools with high specificity scores

  • Include validation of off-target effects through whole-genome sequencing

  • Generate and analyze multiple independent lines for each editing strategy

  • Use appropriate genetic backgrounds (wild-type, reporter lines)

sgRNA design parameters:

ParameterRecommended CriteriaNotes
GC content40-60%Ensures stable Cas9 binding
Self-complementarity<4 bpPrevents secondary structure
Off-target sitesNo sites with ≤3 mismatchesMinimizes off-target effects
Target location5' half of the geneMore likely to create null alleles
PAM proximityTarget conserved residuesFor functional disruption

Analysis workflow for CRISPR-edited plants:

  • Screen T1 plants for editing events using PCR and sequencing

  • Select plants with desired mutations and confirm homozygosity in T2 generation

  • Perform phenotypic characterization:

    • Growth and development under normal conditions

    • Response to various stresses (particularly heat stress based on ATL family function)

    • Molecular phenotypes (ubiquitination patterns, protein accumulation)

  • Perform complementation tests with wild-type ATL79 to confirm phenotypes are due to the targeted mutations

  • Compare with other ATL family mutants to identify unique and overlapping functions

What considerations are important when designing experiments to investigate potential cross-talk between ATL79 and other plant stress signaling pathways?

Investigating cross-talk between ATL79 and other stress signaling pathways requires careful experimental design:

  • Pathway interaction mapping:

    • Epistasis analysis:

      • Create double mutants between atl79 and key components of stress signaling pathways

      • Compare single and double mutant phenotypes to establish genetic relationships

      • Use mutants in hormone signaling (ABA, JA, SA, ethylene) and stress response pathways

    • Transcriptome analysis:

      • Compare expression profiles of atl79 mutants with pathway-specific mutants

      • Identify overlapping sets of differentially expressed genes

      • Use gene set enrichment analysis to identify affected pathways

    • Biochemical interaction studies:

      • Use co-immunoprecipitation to identify physical interactions with signaling components

      • Test for post-translational modifications of ATL79 by stress-activated kinases

      • Investigate whether ATL79 targets components of signaling pathways for ubiquitination

  • Hormone response and signaling integration:

    • Hormone sensitivity assays:

      • Test growth and development of atl79 mutants on media with various hormones

      • Compare with wild-type and hormone signaling mutants

      • Measure hormone levels in atl79 mutants under normal and stress conditions

    • Signaling reporter analysis:

      • Introduce hormone-responsive reporters (e.g., DR5-GUS, ABI4-GUS) into atl79 backgrounds

      • Monitor changes in reporter activity under stress conditions

      • Compare with reporter activity in wild-type plants

  • Multi-stress response analysis:

    • Sequential stress application:

      • Test whether pre-exposure to one stress affects ATL79-dependent responses to a second stress

      • Analyze acclimation responses in wild-type vs. atl79 mutants

    • Combinatorial stress treatments:

      • Apply multiple stresses simultaneously (e.g., heat+drought, pathogen+cold)

      • Compare responses in wild-type and atl79 plants

      • Identify stress combinations with synergistic or antagonistic effects

  • Temporal dynamics of pathway activation:

    • Time-course analysis:

      • Monitor activation of different signaling pathways over time

      • Compare timing in wild-type vs. atl79 mutants

      • Identify primary vs. secondary responses

    • Inducible expression systems:

      • Use chemically inducible ATL79 expression

      • Monitor rapid changes in signaling pathways upon ATL79 induction

Experimental design example for multi-pathway analysis:

TreatmentGenotypeMeasurementsTime Points (h)
ControlWT, atl79, pathway mutantsGene expression, PTMs, Phenotyping0, 1, 3, 6, 24
Stress 1WT, atl79, pathway mutantsGene expression, PTMs, Phenotyping0, 1, 3, 6, 24
Stress 2WT, atl79, pathway mutantsGene expression, PTMs, Phenotyping0, 1, 3, 6, 24
Stress 1→2WT, atl79, pathway mutantsGene expression, PTMs, Phenotyping0, 1, 3, 6, 24
Stress 1+2WT, atl79, pathway mutantsGene expression, PTMs, Phenotyping0, 1, 3, 6, 24

Statistical approach:

  • For pathway interaction analysis: Use factorial ANOVA to detect significant interactions between treatments and genotypes

  • For time-course data: Apply repeated measures ANOVA or mixed models

  • For transcriptome data: Use appropriate multiple testing correction and enrichment analysis

  • For complex designs: Consider multivariate methods to identify patterns across multiple response variables

What ethical considerations should be addressed when conducting research on genetically modified Arabidopsis plants expressing modified ATL79?

Research involving genetically modified Arabidopsis plants expressing modified ATL79 raises several ethical considerations that must be addressed:

  • Biosafety and containment:

    • Implement appropriate biosafety levels for laboratory and greenhouse work

    • Follow institutional and national guidelines for containment of transgenic plants

    • Prevent unintended release of transgenic pollen or seeds

    • Document risk assessment procedures specific to ATL79 modifications

    • While Arabidopsis is not a food crop, proper containment is still ethically required

  • Research integrity and responsible reporting:

    • Maintain accurate records of all experimental procedures and results

    • Report both positive and negative findings

    • Disclose any conflicts of interest related to the research

    • Share detailed methodological information to ensure reproducibility

    • Follow ethical guidelines for authorship and publication

  • Collaborative ethics:

    • Obtain proper permissions when using materials from other researchers

    • Acknowledge the contributions of collaborators and technical staff

    • Establish clear agreements on data ownership and intellectual property

    • Respect the autonomy and perspectives of all team members

  • Resource sharing and open science:

    • Deposit new ATL79 genetic materials in public repositories

    • Share novel ATL79 sequence data in appropriate databases

    • Develop a data management plan for long-term accessibility

    • Consider pre-registration of study designs and analysis plans

    • Public participation in scientific research may be valuable for certain aspects of plant genomics research

  • Societal implications:

    • Consider how research on stress response genes like ATL79 relates to broader issues:

      • Climate change adaptation in agriculture

      • Plant resilience to environmental stresses

      • Potential applications in crop improvement

    • Engage with relevant stakeholders about research implications

    • Communicate research findings responsibly to non-scientific audiences

  • Training and mentoring:

    • Ensure proper training of students and staff in both technical skills and research ethics

    • Promote awareness of ethical considerations specific to plant genetic research

    • Incorporate ethics discussions in research group meetings

    • Develop clear protocols for addressing ethical concerns as they arise

Implementation framework for ethical research:

Ethical ConsiderationImplementation StrategyDocumentation Required
BiosafetyFollow institutional biosafety protocolsBiosafety approval documents
Data integrityUse electronic lab notebooks with version controlRaw data preservation plan
Material sharingDeposit seeds in stock centersMaterial transfer agreements
CollaborationsClear communication of expectationsCollaboration agreements
Open sciencePreprint publication before peer reviewData management plan
Public engagementLay summaries of research findingsCommunication strategy

Decision-making approach:

  • Establish an ethical framework for project planning

  • Consult institutional ethics resources for guidance

  • Include ethics considerations in regular project reviews

  • Document ethical decision-making processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.