Recombinant Arabidopsis thaliana RING-H2 finger protein ATL80 (ATL80)

Shipped with Ice Packs
In Stock

Description

Role in Water Deprivation Stress

ATL80 is rapidly activated under water deprivation, peaking in expression at 60 minutes post-stress. Microarray analyses reveal its involvement in modulating early stress-responsive genes, including:

  • Transcription Factors: ERF/AP2 (e.g., DREB2A) and WRKY families.

  • Signaling Components: Calcium-dependent protein kinases (CDPKs) and MAP kinases.

  • Retrograde Signaling: Core module genes intersecting with chloroplast-nucleus communication pathways.

Key Findings:

StudyObservationSource
Water Deprivation Microarray73 genes co-expressed with ATL80, enriched for CAMTA1/CAMTA5 binding sites.
ATL80 Mutant AnalysisReduced diversity in early stress-responsive gene expression.
Functional HypothesisATL80 targets retrograde signaling components for degradation, acting as a "stress alarm."

E3 Ubiquitin Ligase Activity

ATL80 facilitates ubiquitin transfer via its RING-H2 domain, which binds to E2 enzymes such as Ubc4/Ubc5. This activity is critical for substrate-specific protein degradation:

  • In Vitro Assays: Purified ATL80 catalyzed polyubiquitination in E2-dependent reactions.

  • RING Domain Specificity: Mutation of conserved cysteines (e.g., C123S) abolishes activity.

Substrate Interactions

While direct targets remain under investigation, ATL80 homologs (e.g., ATL8) interact with proteins like Starch Synthase 4, suggesting roles in nutrient/stress adaptation.

Recombinant Production in E. coli

ATL80 is produced in bacterial systems due to challenges in expressing membrane-localized proteins in plants. Key considerations include:

  • Purification: Ni-NTA affinity chromatography (His-tag).

  • Stability: Lyophilized storage (-20°C/-80°C) and glycerol supplementation for long-term stability.

Functional Studies

ATL80 serves as a model for dissecting RING-H2 ligase mechanisms in stress responses. Current research focuses on:

  • Proteomic Profiling: Identifying ubiquitination targets in chloroplast and nuclear compartments.

  • Cross-Species Comparisons: Functional conservation between Arabidopsis ATL80 and rice/rice ATL homologs.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for custom preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
ATL80; At1g20823; F2D10.34; RING-H2 finger protein ATL80; RING-type E3 ubiquitin transferase ATL80
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL80
Target Protein Sequence
MARLLFRLLVESNTPSPAIDNSTAALNSDLVVILAALLCALICVLGLIAVSRCVWLRRLA AGNRTVSGSQTQSPQPPVAAANKGLKKKVLQSLPKLTFSPESPESEKFAECAICLAEFSA GDELRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCHKCGGLPGSSSSGLESEPE IEIRIKQGEDDPNSFLP
Uniprot No.

Target Background

Function

This protein may be involved in the early stages of plant defense signaling pathways.

Database Links

KEGG: ath:AT1G20823

STRING: 3702.AT1G20823.1

UniGene: At.15492

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL80 and how does it fit within the ATL family?

ATL80 is a member of the Arabidopsis Tóxicos en Levadura (ATL) family of RING-H2 ubiquitin ligases. The ATL family is plant-specific and consists of 91 members in Arabidopsis thaliana that contain a distinctive RING-H2 variation and a hydrophobic domain at the N-terminal end . ATL80 is encoded by the gene At1g20823 (ORF name F2D10.34) and produces a protein with UniProt accession number Q9LM69 .

The ATL family has evolved from gene duplication events, with some members arranged in clusters of tandem duplicated genes. While some ATLs like ATL2 and ATL6 have been extensively studied for their roles in plant defense responses, ATL80's specific functions are still being investigated in the context of the broader ATL family's diverse roles in plant development and stress responses .

How is ATL80 gene expression regulated in Arabidopsis?

While specific data on ATL80 regulation is limited, research on other ATL family members provides insights into probable regulatory mechanisms:

  • Pathogen-Associated Molecular Pattern (PAMP) induction: Several ATL genes, including ATL2, show rapid and transient responses to PAMPs within 15-30 minutes of exposure .

  • Post-transcriptional regulation: Many ATL transcripts, including ATL2, have short half-lives due to DST elements in their 3'UTR regions, suggesting ATL80 may be similarly regulated .

  • Defense response pathway: ATL expression can be triggered by defense-related signals independent of de novo protein synthesis, suggesting direct transcriptional activation .

Studies using Advanced Intercross Recombinant Inbred Lines (AI-RILs) in Arabidopsis have proven valuable for mapping regulatory elements controlling gene expression. Similar approaches could be applied to study ATL80 regulation under various environmental conditions .

What are the optimal methods for expressing recombinant ATL80 protein?

For successful expression of functional recombinant ATL80, consider these methodological approaches:

Homologous Expression System (Recommended):
The Arabidopsis-based super-expression system has shown excellent results for expressing plant membrane proteins like those in the ATL family. This system yields up to 0.4 mg of purified protein per gram fresh weight and allows proper post-translational modifications and complex formation with endogenous interaction partners .

Protocol Overview:

  • Clone the ATL80 coding sequence into an appropriate plant expression vector

  • Transform Arabidopsis plants using Agrobacterium-mediated transformation

  • Select transformants and verify expression

  • Harvest tissue and extract protein using appropriate buffers containing detergents for membrane protein solubilization

  • Purify using affinity chromatography

Alternative Expression Systems:

  • In vitro cell-free systems: Useful for rapid production but may lack post-translational modifications

  • E. coli: Challenging for membrane proteins but can be optimized with specific fusion tags

  • Nicotiana benthamiana: Transient expression system useful for preliminary studies

Experimental Considerations:
When designing expression constructs, include appropriate affinity tags for purification (His-tag is commonly used) and consider using TEV protease cleavage sites if tag removal is desired .

How should recombinant ATL80 be stored to maintain activity?

Based on established protocols for recombinant ATL family proteins, the following storage conditions are recommended :

Storage PurposeTemperatureBuffer CompositionDuration
Regular storage-20°CTris-based buffer with 50% glycerolUp to 6 months
Extended storage-80°CTris-based buffer with 50% glycerol>6 months
Working aliquots4°CTris-based bufferUp to 1 week

Important considerations:

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Prepare small aliquots for single use

  • Include reducing agents (such as DTT or β-mercaptoethanol) in storage buffers to maintain the integrity of cysteine residues in the RING-H2 domain

  • Consider adding protease inhibitors to prevent degradation during storage

How can I assess the E3 ligase activity of ATL80 in vitro?

Standard in vitro ubiquitination assay protocol:

  • Components required:

    • Purified recombinant ATL80 protein (E3)

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (preferably from the Ubc4/Ubc5 subfamily)

    • Ubiquitin (consider using tagged ubiquitin for easier detection)

    • ATP and ATP regeneration system

    • Potential substrate (if known)

  • Analysis methods:

    • SDS-PAGE followed by western blotting with anti-ubiquitin antibodies

    • Mass spectrometry to identify ubiquitination sites

Controls to include:

  • Negative control: Reaction without E3 (ATL80)

  • Negative control: Reaction with mutated RING-H2 domain

  • Positive control: Well-characterized E3 ligase with known activity

Studies with other ATL family members have shown that the RING-H2 domain is essential for E3 ligase activity. Key amino acid residues in this domain are critical for binding to E2 enzymes. Site-directed mutagenesis of conserved cysteine or histidine residues can be used to generate inactive controls .

What approaches can be used to identify potential substrates of ATL80?

Identifying E3 ligase substrates remains challenging. Several complementary approaches can be employed:

Yeast Two-Hybrid Screening:

  • Use ATL80 (minus the transmembrane domain) as bait to screen Arabidopsis cDNA libraries

  • Validate interactions with co-immunoprecipitation in planta

  • Note: Some ATL proteins (like ATL2 and ATL63) exhibit toxicity in yeast, which may complicate this approach

Proteomics-Based Approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged ATL80 in Arabidopsis

    • Perform pull-down experiments followed by MS analysis

    • Compare protein abundance in wild-type vs. ATL80 knockout lines

  • Ubiquitin Remnant Profiling:

    • Compare ubiquitinome between wild-type and ATL80 overexpression/knockout lines

    • Focus on proteins with altered ubiquitination patterns

Genetic Approaches:

  • Analyze ATL80 mutant phenotypes and identify genetic suppressors

  • Perform transcriptome analysis to identify altered gene expression

  • Use quantitative trait locus (QTL) mapping with Advanced Intercross RILs to identify genomic regions that interact with ATL80

For all methods, it's critical to validate results with independent techniques and to distinguish direct substrates from proteins affected indirectly by ATL80 activity.

How can I investigate the role of ATL80 in plant defense mechanisms?

Based on studies of other ATL family members, particularly ATL2 and ATL6, the following approaches can be used to investigate ATL80's potential role in plant defense:

Gene Expression Analysis:

  • Monitor ATL80 expression after treatment with:

    • Pathogen-associated molecular patterns (PAMPs) like chitin or cellulases

    • Plant hormones involved in defense (salicylic acid, jasmonic acid, ethylene)

    • Various pathogens (bacteria, fungi, oomycetes)

  • Create transgenic plants with ATL80 promoter-GUS fusions to visualize spatial and temporal expression patterns in response to pathogens

Functional Analysis:

  • Generate and characterize ATL80 knockout and overexpression lines

  • Assess disease resistance/susceptibility phenotypes against diverse pathogens

  • Analyze defense-related gene expression (NPR1, PAL, PR-1, PDF2.1) in these lines

  • Measure defense hormone levels and signaling outputs

Protein Interaction Studies:

  • Identify defense-related proteins that interact with ATL80

  • Determine if these proteins are substrates for ATL80-mediated ubiquitination

  • Investigate how these interactions change during immune responses

Comparative Analysis with Other ATLs:
Several ATL proteins (ATL2, ATL6, ATL31) have established roles in plant defense. Comparing their sequences, expression patterns, and interacting partners with ATL80 can provide insights into shared or unique defense functions .

What experimental designs can reveal ATL80's regulatory network?

To elucidate ATL80's regulatory network, I recommend implementing a multi-faceted experimental strategy:

Transcriptomics Approach:

  • RNA-Seq analysis comparing wild-type, ATL80 knockout, and ATL80 overexpression lines under:

    • Normal growth conditions

    • Stress conditions (biotic and abiotic)

    • Different developmental stages

  • Time-course experiments to capture dynamic changes in gene expression

Protein-Protein Interaction Network:

  • Yeast two-hybrid screening with different domains of ATL80

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) to validate interactions in planta

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

Genetic Interaction Mapping:

  • Create double mutants with genes in predicted pathways

  • Use Advanced Intercross RILs (AI-RILs) for QTL mapping of traits potentially regulated by ATL80

  • Suppress-enhance screens to identify genetic modifiers

Post-Translational Modifications (PTMs):

  • Identify proteins whose ubiquitination status changes in ATL80 mutants

  • Map ubiquitination sites using mass spectrometry

  • Analyze changes in protein stability and turnover rates

Data Integration:
Integrate data from all approaches using network analysis tools to build a comprehensive regulatory model. This should include direct and indirect interactions, as well as feedback mechanisms that regulate ATL80 itself.

What are common challenges in expressing functional ATL80 and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant ATL80:

Challenge 1: Low protein solubility

  • Cause: ATL80 contains a transmembrane domain that can cause aggregation

  • Solutions:

    • Use homologous Arabidopsis expression systems instead of bacterial systems

    • Express only the RING-H2 domain for functional studies

    • Use specialized detergents (0.5-1% CHAPS or DDM) during extraction

    • Include 10% glycerol in all buffers to improve stability

    • Perform extraction and purification at 4°C

Challenge 2: Loss of E3 ligase activity

  • Cause: Oxidation of critical cysteine residues in the RING-H2 domain

  • Solutions:

    • Add reducing agents (1-5 mM DTT or TCEP) to all buffers

    • Avoid repeated freeze-thaw cycles

    • Work in oxygen-depleted buffers when possible

    • Perform activity assays immediately after purification

Challenge 3: Protein degradation

  • Cause: Proteolytic enzymes in plant extracts

  • Solutions:

    • Include protease inhibitor cocktail during extraction

    • Perform purification rapidly at low temperatures

    • Add 50% glycerol for storage

    • Verify protein integrity by western blot before functional assays

Challenge 4: Low expression levels

  • Cause: Toxicity or regulatory feedback

  • Solutions:

    • Use inducible expression systems

    • Co-express with E2 enzyme partners

    • Try the Arabidopsis super-expression system that has yielded up to 0.4 mg of purified protein per gram fresh weight

    • Express in cell-free systems if membrane association is problematic

How can contradictory data regarding ATL80 function be interpreted?

When faced with contradictory results regarding ATL80 function, consider these analytical approaches:

1. Experimental Context Analysis
Compare all experimental parameters that might influence results:

  • Plant growth conditions (light, temperature, humidity)

  • Developmental stage of plants used

  • Tissue-specific expression patterns

  • Experimental timelines (especially important for early response genes like ATLs)

2. Genetic Background Effects
The Advanced Intercross RIL (AI-RIL) studies have shown that genetic background significantly impacts gene function in Arabidopsis . Consider:

  • Whether different ecotypes were used across studies

  • Presence of segregation distortion that may affect phenotype interpretation

  • Epistatic interactions that modify ATL80 function in different backgrounds

3. Specificity vs. Redundancy
The ATL family has 91 members in Arabidopsis with potential functional overlap :

  • Test for compensatory expression of other ATL genes in ATL80 mutants

  • Perform phylogenetic analysis to identify closely related ATLs

  • Consider creating multiple knockout lines of related ATLs

4. Technical Validation
For each contradictory result:

  • Verify protein expression and activity using multiple methods

  • Ensure specificity of antibodies or detection methods

  • Use multiple biological and technical replicates

  • Include appropriate positive and negative controls

5. Data Integration Approaches
When results cannot be reconciled experimentally:

  • Create hypothetical models that explain different outcomes

  • Design experiments to test these models directly

  • Consider that ATL80 may have context-dependent functions

What controls are essential when studying ATL80's E3 ligase activity?

A robust experimental design for studying ATL80's E3 ligase activity must include the following controls:

Essential Negative Controls:

  • Enzymatic Component Omissions:

    • Reaction without E1 enzyme

    • Reaction without E2 enzyme

    • Reaction without ATL80 (E3)

    • Reaction without ATP (energy source)

    • Reaction without ubiquitin

  • Structural Controls:

    • ATL80 with mutated RING-H2 domain (substitute critical cysteine residues)

    • Denatured ATL80 protein

    • RING-H2 domain alone (to determine if other domains are required)

Essential Positive Controls:

  • Known E3 Ligase System:

    • Well-characterized E3 ligase (such as AtATL2) with its cognate E2 enzyme

    • If possible, ATL80 with its known substrate (if identified)

  • E2 Specificity Controls:

    • Test multiple E2 enzymes, especially from the Ubc4/Ubc5 subfamily which has been shown to work with other ATL proteins

    • Include the human or yeast E2 (UbcH5 or Ubc4) as a reference

Additional Validation Controls:

  • Ubiquitin Variants:

    • Methylated ubiquitin (prevents chain formation) to distinguish between mono- and poly-ubiquitination

    • Ubiquitin mutants (K48R, K63R) to determine linkage specificity

  • Time-Course Analysis:

    • Sample reactions at different time points to track progression

    • Determine optimal time for activity measurements

  • Concentration Dependencies:

    • Titrate ATL80 concentration to establish enzyme kinetics

    • Vary substrate concentration if a substrate is available

Data Analysis Controls:

  • Technical Replicates: Minimum of three independent experiments

  • Western Blot Controls: Include molecular weight markers and loading controls

  • Mass Spectrometry Controls: Include isotope-labeled standards for quantification

How is ATL80 research contributing to our understanding of plant ubiquitination networks?

ATL80 research offers unique opportunities to expand our knowledge of plant ubiquitination networks in several key areas:

Membrane-Associated E3 Ligase Functions:
ATL80 and other ATL family members possess transmembrane domains that anchor them to cellular membranes, potentially enabling them to regulate membrane protein turnover and vesicle trafficking . This membrane association distinguishes them from soluble E3 ligases and may reveal new mechanisms of protein quality control at cellular membranes.

Stress Response Integration:
Several ATL family members respond rapidly to biotic and abiotic stresses. ATL80 research may reveal how ubiquitination networks coordinate multiple stress responses and prioritize cellular responses under combined stress conditions .

Evolution of E3 Ligase Families:
The ATL family has expanded significantly in plants compared to other organisms, with numbers ranging from 20-28 members in basal species to 162 in soybean . Comparative studies including ATL80 can provide insights into:

  • How E3 ligase families evolve and diversify

  • How substrate specificity changes through evolution

  • The relationship between gene duplication and functional specialization

E2-E3 Specificity Determinants:
ATL proteins like ATL80 show specificity for the Ubc4/Ubc5 subfamily of E2 enzymes . Structural and functional analysis of this interaction can reveal molecular determinants of E2-E3 recognition, which is fundamental to understanding ubiquitination pathway specificity.

What emerging technologies could advance ATL80 research?

Several cutting-edge technologies show promise for deepening our understanding of ATL80:

CRISPR-Based Technologies:

  • Base editing: For introducing precise mutations in the RING-H2 domain without disrupting the entire gene

  • CRISPRi/CRISPRa: For temporal control of ATL80 expression

  • CRISPR screens: To identify genetic interactions with ATL80

Advanced Imaging Techniques:

  • Super-resolution microscopy: To visualize ATL80 localization at subcellular membranes

  • FRET-FLIM: To detect protein-protein interactions in living cells

  • Single-molecule tracking: To follow ATL80-mediated ubiquitination events in real-time

Structural Biology Approaches:

  • Cryo-EM: To determine the structure of ATL80 in complex with E2 enzymes and substrates

  • Hydrogen-deuterium exchange mass spectrometry: To map protein interaction interfaces

  • AlphaFold and related AI tools: To predict structural features and guide experimental design

Systems Biology Integration:

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and metabolomics data

  • Network modeling: To place ATL80 in the context of broader cellular networks

  • Single-cell analysis: To understand cell type-specific functions of ATL80

Plant Phenotyping Technologies:

  • High-throughput phenotyping platforms: To characterize subtle phenotypes in ATL80 mutants

  • Environmental simulation chambers: To test ATL80 function under diverse stress conditions

  • Field-based phenotyping: To validate laboratory findings in natural environments

These technologies, combined with the Arabidopsis super-expression system that has been successful for other plant proteins , position ATL80 research at the forefront of understanding plant ubiquitination mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.