Recombinant Arabidopsis thaliana RING-H2 finger protein ATL8 (ATL8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL8; At1g76410; F14G6.1; F15M4.9; RING-H2 finger protein ATL8; RING-type E3 ubiquitin transferase ATL8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL8
Target Protein Sequence
MARLLFRLLQEANSTSPAEASPPFNSDLVLILAVLLCALTCIIGLIAVSRCAWLRRIASR NRSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPDSPPAEKLVECAICLTEFAAGDELRVL PQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCHKCGGLPGSSSSGPEPDTRIKQREDG PDNLP
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G76410

STRING: 3702.AT1G76410.1

UniGene: At.34661

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the domain structure of ATL8 and how does it relate to its function?

ATL8 belongs to the Arabidopsis Tóxicos en Levadura (ATL) family, a group of plant-specific RING-type ubiquitin ligases. Its protein structure consists of:

  • A single transmembrane-like hydrophobic amino acid region (amino acids 31–53) at its N-terminus

  • A RING-H2 type zinc finger domain in its middle portion

  • Additional regulatory regions

This domain architecture is critical for ATL8's function as a membrane-localized E3 ubiquitin ligase. The N-terminal hydrophobic region anchors the protein to membrane compartments, while the RING-H2 domain facilitates the transfer of ubiquitin to target substrates. When expressing recombinant ATL8 protein, researchers typically delete the N-terminal hydrophobic and basic regions as they inhibit sufficient protein expression in E. coli systems .

A critical residue in the RING domain is the conserved cysteine at position 123. Mutation of this residue to serine (C123S) abolishes ubiquitin ligase activity, making this a valuable tool for creating inactive variants for experimental controls and localization studies .

How is ATL8 expression regulated in Arabidopsis thaliana?

ATL8 expression is tightly regulated by multiple environmental factors and signaling pathways:

What cellular compartments is ATL8 localized to?

ATL8 is primarily a membrane-localized protein, consistent with the presence of its N-terminal transmembrane-like hydrophobic domain. Experimental evidence for ATL8's localization includes:

  • Confocal microscopy analysis: When ATL8C123S-GFP (an enzymatically inactive variant that prevents protein degradation) is co-expressed with the membrane marker FLS2-mCherry in Nicotiana benthamiana leaves, the GFP signal is present at the cell periphery and highly overlaps with FLS2-mCherry .

  • Endosomal localization: ATL8C123S-GFP has also been observed in dot-like structures in the cytosol, suggesting localization to endosomal compartments, particularly in mesophyll protoplast cells .

  • Fractionation analysis: Protein extraction experiments with and without detergent (1% Triton X-100) followed by ultracentrifugation provide further evidence of membrane association. Without detergent, ATL8C123S-GFP is detected in the insoluble fraction; with detergent, it is found in the soluble fraction, confirming its membrane association .

This membrane localization is functionally significant, as it positions ATL8 to interact with specific substrates in cellular compartments where it mediates ubiquitination events critical for regulatory processes.

What are the optimal methods for expressing recombinant ATL8 protein?

Expressing recombinant ATL8 presents several challenges that require specific methodological approaches:

  • Construct design: Due to the inhibitory effects of ATL8's N-terminal hydrophobic region and basic regions on protein expression in E. coli, these regions should be deleted. Research has demonstrated success using a truncated version comprising residues 71 (valine) to 185 (phenylalanine) .

  • Fusion tags: Fusion with maltose binding protein (MBP) has proven effective for enhancing solubility and expression levels of ATL8. The MBP-ATL8 fusion protein can be purified and subsequently used for in vitro ubiquitination assays .

  • E. coli expression optimization: When expressing ATL8 in E. coli, several parameters should be considered:

    • Temperature: Lower temperatures (16-18°C) during induction may improve protein folding

    • IPTG concentration: Typically 0.1-0.5 mM for balanced expression

    • Expression time: 4-16 hours post-induction depending on stability

  • Mutation considerations: For localization studies, the C123S mutation in the RING domain prevents ubiquitin ligase activity, resulting in more stable protein that can be visualized without rapid degradation .

For plant expression systems, using the ATL8C123S variant fused to a fluorescent reporter like GFP under a constitutive promoter has proven effective for localization and interaction studies .

How can ATL8 ubiquitin ligase activity be assessed in vitro?

In vitro ubiquitination assays provide a direct method to assess ATL8's enzymatic activity:

  • Reagent preparation:

    • Purified recombinant MBP-ATL8 (or variant)

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme

    • Ubiquitin

    • ATP and reaction buffer containing Mg²⁺

  • Assay procedure:

    • Incubate all components at appropriate concentrations

    • Sample the reaction at different time points (e.g., 0, 30, 120 minutes)

    • Analyze by SDS-PAGE followed by western blotting with anti-ubiquitin antibody

  • Controls and validation:

    • Include a negative control using an inactive variant (e.g., MBP-ATL8C123S)

    • The active ATL8 should generate a heterogeneous collection of higher molecular weight ubiquitinated products

    • The inactive C123S variant should abolish this pattern of ubiquitination

This methodology has successfully demonstrated that ATL8 possesses RING-type ubiquitin ligase activity in vitro, with the conserved cysteine at position 123 being essential for this activity.

What approaches can be used to identify ATL8 interaction partners?

Several complementary approaches have proven effective for identifying ATL8 interaction partners:

  • Immunoprecipitation coupled with mass spectrometry:

    • Express tagged ATL8 (preferably ATL8C123S-GFP to prevent degradation) in transgenic Arabidopsis

    • Extract proteins with appropriate detergents to solubilize membrane proteins

    • Immunoprecipitate using anti-tag antibodies (e.g., anti-GFP beads)

    • Identify co-precipitated proteins by mass spectrometry

    This approach successfully identified Starch Synthase 4 (SS4) as a putative ATL8 interactor .

  • Yeast two-hybrid screening:

    • For membrane proteins like ATL8, modified approaches such as split-ubiquitin yeast two-hybrid may be more appropriate

    • The catalytically inactive C123S variant should be used to prevent degradation of interaction partners

  • Bimolecular fluorescence complementation (BiFC):

    • Split fluorescent proteins fused to ATL8 and candidate interactors

    • Co-expression in plant cells

    • Visualization by confocal microscopy to detect reconstituted fluorescence

  • Co-localization studies:

    • Co-expression of fluorescently tagged ATL8 and candidate interactors

    • Analysis of subcellular distribution and overlap by confocal microscopy

    This approach was used to demonstrate that ATL8C123S-GFP co-localizes with the membrane marker FLS2-mCherry .

  • In vitro pull-down assays:

    • Purified recombinant ATL8 incubated with plant extracts

    • Analysis of bound proteins by western blotting or mass spectrometry

How does ATL8 contribute to phosphate homeostasis in Arabidopsis?

ATL8 plays a significant role in phosphate (Pi) homeostasis through multiple mechanisms:

  • Regulation of root development: ATL8 mediates root architectural responses to Pi availability. Mutant analysis reveals:

    • Significant reductions in different root traits in atl8 mutants compared to wild-type under various Pi regimes

    • Decreased root hair development in atl8 mutants

    • Reduced root-to-shoot ratio in atl8 mutants

    • Conversely, overexpression lines (Oe1 and Oe2) show enhancement in these traits

  • Modulation of Pi uptake and content:

    • Total Pi content is significantly reduced in atl8 mutants compared to wild-type

    • This suggests ATL8 positively regulates Pi acquisition and/or retention

  • Regulation of gene expression: ATL8 influences the expression of genes involved in Pi homeostasis:

    • WRKY75 (transcription factor regulating Pi starvation responses)

    • RNS1 (ribonuclease induced by Pi starvation)

    • E3L (E3 ubiquitin ligase involved in Pi signaling)

    • ACP5 (acid phosphatase)

    These genes are differentially modulated in atl8 mutants and overexpression lines under different Pi regimes .

  • Interaction with phytohormone signaling:

    • Abscisic acid (ABA) treatment leads to increased primary root length in atl8 mutants compared to wild-type

    • This suggests cross-talk between ABA and ATL8 in regulating root growth responses to Pi availability

These findings collectively indicate that ATL8 integrates multiple signaling pathways to coordinate morphophysiological and molecular adaptive responses to Pi deficiency in Arabidopsis.

What is the relationship between ATL8 and sugar starvation response?

ATL8 functions as a key component in the sugar starvation response network:

  • Expression regulation:

    • ATL8 expression is significantly increased under sugar starvation conditions

    • Expression is repressed by exogenous sugar supply

    • Extended darkness (which depletes sugars) enhances ATL8 expression

    • This regulation is mediated by the SnRK1 energy sensing pathway

  • Coordination with metabolic pathways:

    • ATL8 expression is highly coordinated with genes involved in branched chain amino acid (BCAA) catabolism, including:

      • Isovaleryl-CoA dehydrogenase (IVD)

      • Dihydrolipoamide branched chain acyltransferase (BCE2/DIN3)

      • Branched chain alpha-keto acid dehydrogenase E1 beta (DIN4)

      • Branched-chain alpha-keto acid decarboxylase E1 Beta subunit (BCDH BETA1)

      • 3-methycrotonyl-CoA carboxylase (MCCB)

  • Potential role in starch metabolism:

    • ATL8 interacts with Starch Synthase 4 (SS4), suggesting involvement in modulating starch accumulation in response to sugar availability

    • This connection provides a link between ubiquitin-mediated protein regulation and carbohydrate metabolism

  • Alternative respiration:

    • The coordination with BCAA degradation enzymes suggests ATL8 may indirectly influence the alternative respiratory chain

    • BCAA degradation provides electrons to the ubiquinol pool via the ETF/ETFQO system during sugar starvation stress

These findings indicate that ATL8 likely functions as a regulatory ubiquitin ligase that helps plants adapt to sugar starvation conditions by modulating protein turnover in key metabolic pathways.

How do ATL8 mutants and overexpression lines differ in their phenotypes?

Comparative analysis of ATL8 mutants and overexpression lines reveals distinctive phenotypic differences:

Phenotypic Traitatl8 MutantOverexpression Lines (Oe1, Oe2)Wild-type
Root traits under Pi deficiencySignificantly reducedEnhancedIntermediate
Root hair developmentReducedEnhancedIntermediate
Root-to-shoot ratioDecreasedIncreasedIntermediate
Total Pi contentReducedSimilar to or higher than WTReference
Anthocyanin accumulation under Pi deficiencySimilar to WTSignificantly reducedReference
Primary root length with ABA treatmentIncreasedNot reportedReference

Additionally, the gene expression profiles differ significantly:

  • Expression of Pi homeostasis genes:

    • WRKY75, RNS1, E3L, and ACP5 are differentially modulated in atl8 and overexpression lines compared to wild-type under different Pi regimes

    • This indicates that ATL8 influences the transcriptional regulation of these genes

  • Sugar starvation responsive genes:

    • The expression of genes involved in BCAA catabolism correlates with ATL8 expression levels

    • This suggests ATL8 may participate in regulating metabolic adaptation to energy limitation

These phenotypic and molecular differences demonstrate that ATL8 plays a critical role in integrating nutrient signaling (particularly phosphate) and energy status (sugar availability) to coordinate appropriate developmental and physiological responses.

How should researchers approach contradictory data when studying ATL8?

When encountering contradictory results in ATL8 research, consider these methodological approaches:

  • Experimental conditions standardization:

    • ATL8 expression is highly sensitive to sugar and phosphate levels

    • Ensure consistent growth media composition, light conditions, and plant age

    • Document time of day for sampling due to potential circadian effects

    • Control for stress factors that may indirectly affect sugar or phosphate status

  • Genetic background considerations:

    • Verify the genetic background of mutant and transgenic lines

    • Conduct complementation tests to confirm phenotypes are due to ATL8

    • Generate multiple independent transgenic lines to rule out position effects

  • Expression level analysis:

    • Quantify ATL8 expression levels in all experimental lines

    • Consider that post-translational regulation may result in differences between transcript and protein levels

    • Use both RT-PCR and protein detection methods when possible

  • Substrate specificity:

    • As an E3 ubiquitin ligase, ATL8 likely has multiple substrates

    • Different experimental conditions may affect distinct subsets of ATL8 targets

    • This could explain seemingly contradictory phenotypes under different conditions

  • Integration of multiple signaling pathways:

    • ATL8 responds to both sugar and phosphate availability

    • Contradictory results may reflect different relative strengths of these signals

    • Design experiments that systematically vary both factors to create response matrices

What are the key methodological considerations for in vitro characterization of ATL8?

In vitro characterization of ATL8 requires attention to several critical parameters:

  • Protein expression and purification:

    • The N-terminal hydrophobic and basic regions inhibit expression in E. coli

    • Use truncated versions (e.g., residues 71-185) fused to solubility tags like MBP

    • Include protease inhibitors during purification to prevent degradation

    • Consider using the C123S variant for interaction studies to prevent substrate degradation

  • Ubiquitination assay optimization:

    • Test multiple E2 ubiquitin-conjugating enzymes to identify optimal combinations

    • Include controls with inactive ATL8 variants (C123S)

    • Optimize reaction conditions (buffer composition, temperature, time)

    • Use sensitive detection methods (anti-ubiquitin western blotting)

  • Subcellular localization studies:

    • Express ATL8 at levels similar to endogenous expression to avoid artifacts

    • Use the C123S variant to prevent autoubiquitination and degradation

    • Include appropriate membrane markers for co-localization

    • Perform fractionation studies to biochemically validate microscopy results

  • Interaction partner identification:

    • Consider membrane solubilization conditions carefully

    • Use crosslinking approaches to capture transient interactions

    • Validate interactions through multiple independent methods

    • Remember that as an E3 ligase, ATL8 interactions with substrates may be transient

These methodological considerations are essential for generating reliable and reproducible data when characterizing ATL8 in vitro.

How can researchers effectively study the physiological roles of ATL8 in planta?

To effectively investigate ATL8's physiological functions in plants, researchers should consider these approaches:

  • Genetic resources:

    • Use multiple allelic mutants when available

    • Generate CRISPR/Cas9 knockout lines as complementary resources

    • Create conditional expression systems (e.g., estradiol-inducible) for temporal control

    • Develop tissue-specific expression lines to dissect local functions

  • Physiological assays:

    • Design experiments that systematically vary both phosphate and sugar availability

    • Include time-course studies to capture dynamic responses

    • Measure multiple parameters (growth, metabolite levels, gene expression)

    • Quantify root system architecture using standardized imaging protocols

  • Molecular analyses:

    • Profile transcriptomes under defined conditions

    • Use phosphoproteomics to identify potential regulatory events

    • Conduct metabolomics to capture broader metabolic effects

    • Employ chromatin immunoprecipitation (ChIP) to identify transcription factors mediating ATL8 expression changes

  • Substrate identification strategies:

    • Compare ubiquitination profiles between wild-type and atl8 mutants

    • Use proximity labeling approaches (BioID, TurboID) to identify proteins in ATL8's vicinity

    • Create conditional expression systems for ATL8 to capture immediate ubiquitination targets

    • Focus on candidates like Starch Synthase 4 that have been identified as interactors

  • Environmental response analysis:

    • Test responses to combined stresses (e.g., nutrient limitation plus drought)

    • Investigate ATL8 function across developmental stages

    • Examine potential roles in seasonal adaptation

    • Consider circadian regulation of ATL8 activity

These comprehensive approaches will help researchers develop a more complete understanding of ATL8's diverse physiological roles in plant development and stress responses.

What emerging technologies could advance our understanding of ATL8 function?

Several cutting-edge technologies offer promising avenues for deeper insights into ATL8 biology:

  • Cryo-electron microscopy:

    • Determine the 3D structure of ATL8 in complex with substrates

    • Visualize conformational changes during the ubiquitination cycle

    • Provide structural insights for rational design of functional variants

  • Proximity-dependent labeling:

    • Fusion of ATL8 with BioID or TurboID enzymes

    • Enables identification of proteins in close proximity to ATL8 in vivo

    • Can reveal transient interactions that are difficult to capture by co-immunoprecipitation

    • Particularly valuable for membrane-associated proteins like ATL8

  • Single-cell transcriptomics and proteomics:

    • Reveal cell-type specific functions of ATL8

    • Identify tissues where ATL8 activity is most critical

    • Uncover heterogeneity in ATL8 responses within tissues

  • CRISPR-based screens:

    • Create genome-wide knockout libraries in protoplasts

    • Screen for modifiers of ATL8 phenotypes

    • Identify redundant proteins that may compensate for ATL8 loss

  • Protein degradation dynamics:

    • Use fluorescent timers or optical pulse-chase methods

    • Measure the half-life of ATL8 substrates in vivo

    • Quantify how substrate degradation rates change under various conditions

These technologies would significantly advance our mechanistic understanding of ATL8's biological functions and regulatory networks.

How can systems biology approaches elucidate ATL8's role in plant adaptation?

Systems biology offers powerful frameworks to understand ATL8's position in broader regulatory networks:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and phenomics data

    • Create computational models of ATL8-regulated processes

    • Use machine learning to identify patterns in complex datasets

    • Predict emergent properties of the system that can be experimentally tested

  • Network analysis:

    • Construct protein-protein interaction networks centered on ATL8

    • Map transcriptional regulatory networks controlling ATL8 expression

    • Identify regulatory motifs and feedback loops involving ATL8

    • Compare networks across different stress conditions

  • Genome-scale metabolic modeling:

    • Integrate ATL8-mediated changes into metabolic flux models

    • Predict metabolic consequences of ATL8 perturbation

    • Identify key branch points where ATL8 regulation has maximal impact

  • Cross-species comparative analysis:

    • Compare ATL8 orthologs across plant species

    • Identify conserved and divergent functions

    • Link evolutionary conservation to specific environmental adaptations

    • ATL8 belongs to group K of the ATL family, which includes ATL80, involved in phosphate mobilization and cold stress response

  • Spatial modeling:

    • Create tissue and subcellular spatiotemporal models of ATL8 activity

    • Simulate how membrane localization affects substrate availability

    • Predict how changes in protein localization alter system behavior

These systems-level approaches would position ATL8 within the complex regulatory networks that mediate plant adaptation to changing environmental conditions.

What are the translational implications of ATL8 research for crop improvement?

Understanding ATL8 function has several potential applications for crop improvement:

  • Nutrient use efficiency enhancement:

    • ATL8's role in phosphate homeostasis suggests potential for improving phosphate acquisition

    • Modulating ATL8 expression or activity could enhance root development under low phosphate conditions

    • This could reduce fertilizer requirements and environmental impacts

  • Stress tolerance engineering:

    • ATL8's involvement in sugar starvation responses may be leveraged to improve energy management under stress

    • Enhanced survival under energy-limiting conditions could improve yield stability

    • Cross-talk with ABA signaling suggests potential roles in drought tolerance

  • Root system architecture optimization:

    • ATL8 modulates root traits including root hairs and root-to-shoot ratio

    • These traits are critical for water and nutrient acquisition

    • Targeted modification of ATL8 activity could create designer root systems for specific soil conditions

  • Metabolic engineering targets:

    • ATL8's interaction with Starch Synthase 4 suggests potential roles in starch metabolism

    • Altering this interaction could potentially modulate carbon partitioning

    • This could enhance yield or quality traits in starch-accumulating crops

  • Diagnostic markers:

    • ATL8 expression patterns could serve as molecular markers for nutrient or energy status

    • This could inform precision agriculture applications

    • Monitoring ATL8 expression could provide early warning of stress conditions

These translational applications highlight the importance of fundamental research on ATL8 for addressing practical challenges in agriculture and food security.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.