Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 1 (SCAMP1)

Shipped with Ice Packs
In Stock

Description

Introduction to SCAMP1 in Arabidopsis thaliana

SCAMP1 is a member of the secretory carrier membrane protein (SCAMP) family, conserved across eukaryotes. In plants, SCAMP1 plays a role in post-Golgi membrane trafficking, including endocytosis and exocytosis. It is localized to the plasma membrane (PM) and trans-Golgi network (TGN), with dynamic relocalization during cellular processes like cytokinesis .

Primary Sequence and Gene Information

The Arabidopsis thaliana SCAMP1 protein (UniProt ID: Q9SKT3) comprises 282 amino acids (AA) with a calculated molecular weight of 31.8 kDa. It is encoded by the At2g20840 gene and shares structural homology with SCAMP homologs in other organisms, including mammals and rice .

AttributeValue
AA SequenceMSRYQSHSFDDGEINPFANPTSVPAATSKLSPLPPEPYDRGATMDIPLDSGKDLKAKEKE LREKEAELKRREQEIKRKEDAIAQAGIVIEEKNWPPFFPLIHHDISNEIPIHLQRIQYVA FTSMLGLVVCLLWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRAMRTD SALKFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFYFIGFG FFCLESLVSIWVIQQVYMYFRGSGKAAEMKQEATRRAMMAAL
Transmembrane DomainsFour transmembrane spans (TMD1–TMD4), with cytosolic N- and C-termini .
Genomic ContextPart of a gene family with paralogs atSC2 (AC002560) and atSC3 (AC002294) .

SCAMP Family in Arabidopsis

IsoformGenBank EntryPredicted SizeSource
atSC1AC006234 (G)289 AA; 31.8 kDa
atSC2AC002560 (G)281 AA; 31.8 kDa
atSC3AC002294 (G)289 AA; 32.6 kDa

Production and Purification

Recombinant SCAMP1 is expressed in E. coli as a full-length protein fused to an N-terminal His tag. Key production details include:

ParameterSpecification
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage .
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C .

Trafficking Pathways

SCAMP1 traffics via an ER→Golgi→TGN→PM pathway in plant cells. Mutational studies in tobacco BY-2 cells revealed:

  • Cytosolic N-terminus: Contains an ER export signal .

  • TMD2/TMD3: Essential for Golgi export .

  • TMD1: Critical for TGN-to-PM targeting .

DomainRole in TraffickingExperimental Evidence
N-terminusER export signalLoss-of-function mutants .
TMD2/TMD3Golgi exportMutants disrupt Golgi exit .
TMD1TGN-to-PM targetingMutants accumulate in TGN .

Role in Cytokinesis

During plant cell division, SCAMP1 concentrates at the cell plate, a structure formed during cytokinesis . This relocalization suggests a role in:

  • Membrane remodeling: Directing TGN-derived vesicles to the cell plate .

  • Cargo sorting: Shifting from PM recycling to cell plate formation .

Applications and Research Tools

SCAMP1 serves as a marker for TGN/early endosomes in plant cells. For example:

  • OsSCAMP1-YFP fusions: Used to track TGN dynamics during cytokinesis .

  • Protease protection assays: Confirm topology in intact vesicles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SCAMP1; SC1; At2g20840; F5H14.19; Secretory carrier-associated membrane protein 1; AtSC1; Secretory carrier membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SCAMP1
Target Protein Sequence
MSRYQSHSFDDGEINPFANPTSVPAATSKLSPLPPEPYDRGATMDIPLDSGKDLKAKEKE LREKEAELKRREQEIKRKEDAIAQAGIVIEEKNWPPFFPLIHHDISNEIPIHLQRIQYVA FTSMLGLVVCLLWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRAMRTD SALKFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFYFIGFG FFCLESLVSIWVIQQVYMYFRGSGKAAEMKQEATRRAMMAAL
Uniprot No.

Target Background

Function

Likely involved in membrane trafficking.

Database Links

KEGG: ath:AT2G20840

STRING: 3702.AT2G20840.1

UniGene: At.28122

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is SCAMP1 and what is its evolutionary significance?

SCAMP1 (Secretory carrier-associated membrane protein 1) belongs to a family of integral membrane proteins found in secretory and endocytic carriers that function in membrane trafficking. The SCAMP family is broadly conserved across the plant and animal kingdoms, though notably absent in fungi. This evolutionary conservation suggests critical cellular functions maintained throughout eukaryotic evolution .

The high degree of conservation in SCAMPs, particularly in their membrane core containing four putative transmembrane spans and three amphiphilic segments, indicates strong selective pressure to maintain these structural elements across diverse species. In Arabidopsis thaliana, SCAMP1 (also annotated as SC1 or AT2G20840) serves essential functions in vesicular transport systems that may be fundamental to plant cellular organization.

What are the key structural features of SCAMP1?

The SCAMP1 protein shares several characteristic structural motifs with other members of the SCAMP family. These include:

  • N-terminal domain features:

    • NPF repeats (asparagine-proline-phenylalanine)

    • Leucine heptad repeat enriched in charged residues

    • Proline-rich SH3-like and/or WW domain-binding sites

  • Membrane core containing:

    • Four putative transmembrane spans

    • Three amphiphilic segments (the most highly conserved structural elements)

The typical SCAMP proteins (including Arabidopsis SCAMP1) are 32-38 kDa in size, while mammalian SCAMP4 (a truncated variant) is approximately 25 kDa and lacks most of the N-terminal hydrophilic domain present in other SCAMPs. This truncated version still functions, suggesting that the membrane core portion of the larger SCAMPs may encode the primary functional domain .

How is recombinant Arabidopsis thaliana SCAMP1 typically expressed for research applications?

Recombinant Arabidopsis thaliana SCAMP1 can be expressed through multiple host systems, each offering distinct advantages depending on research objectives. Based on available expression systems, researchers typically employ:

Expression SystemAdvantagesCommon Applications
E. coliHigh yield, cost-effective, rapid expressionStructural studies, antibody production
YeastPost-translational modifications, proper foldingFunctional studies requiring eukaryotic modifications
BaculovirusComplex protein expression, higher eukaryotic PTMsInteraction studies, functional assays
Mammalian CellMost authentic PTMs, proper foldingTrafficking studies, interaction analysis
Cell-Free ExpressionRapid production, avoids toxicity issuesPreliminary studies, difficult-to-express proteins

For Arabidopsis SCAMP1, cell-free expression systems have been successfully employed to produce protein with greater than 85% purity as determined by SDS-PAGE . This approach is particularly useful when studying plant membrane proteins that may be toxic when expressed in bacterial systems.

What experimental approaches are most effective for studying SCAMP1 localization in plant cells?

Studying SCAMP1 localization in plant cells requires specialized techniques that preserve membrane structures while providing sufficient resolution. The most effective approaches include:

  • Immunohistochemistry with specific SCAMP1 antibodies:

    • This technique allows visualization of native SCAMP1 in fixed plant tissues

    • Critical factors include proper fixation to preserve membrane integrity and antibody specificity

    • Antigen retrieval methods may be necessary for optimal detection

  • Fluorescent protein fusion constructs:

    • Creating GFP-SCAMP1 or similar fusion proteins for live-cell imaging

    • Care must be taken to ensure the tag doesn't interfere with localization or function

    • Both N- and C-terminal fusions should be tested to minimize artifacts

  • Subcellular fractionation followed by Western blotting:

    • This biochemical approach allows quantitative assessment of SCAMP1 distribution

    • Western blotting protocols should be optimized using available SCAMP1 antibodies that demonstrate high specificity

    • Purification steps should utilize affinity-purified antibodies for best results

When implementing these approaches, researchers should validate findings through multiple complementary methods to overcome limitations inherent to any single technique.

How can researchers effectively purify recombinant SCAMP1 while maintaining protein integrity?

Purification of recombinant SCAMP1 presents challenges common to membrane proteins. The following protocol incorporates strategies to maintain protein integrity:

  • Extraction optimization:

    • Use mild detergents (e.g., DDM, CHAPS) to solubilize membrane-bound SCAMP1

    • Include protease inhibitors to prevent degradation during extraction

    • Perform extractions at 4°C to minimize protein denaturation

  • Purification strategy:

    • Employ affinity chromatography using His-tagged constructs or specific antibodies

    • Follow with size exclusion chromatography to separate intact protein from degradation products

    • Consider using styrene-maleic acid lipid particles (SMALPs) to maintain native lipid environment

  • Quality control:

    • Verify purity using SDS-PAGE (aim for ≥85% purity)

    • Confirm identity through Western blotting with specific antibodies

    • Assess functionality through reconstitution assays or binding studies

Researchers should note that limited proteolysis studies on SCAMP1 have provided insights into its structure, suggesting that careful monitoring of proteolytic degradation during purification is essential .

What are the current limitations in SCAMP1 functional studies and how can they be addressed?

Current limitations in functional studies of Arabidopsis SCAMP1 include:

  • Redundancy challenges:

    • Multiple SCAMP isoforms may compensate for each other in knockout studies

    • Solution: Employ CRISPR/Cas9 to generate multiple knockouts simultaneously or use inducible knockdown approaches

  • Membrane protein mobility restrictions:

    • Traditional yeast two-hybrid systems are ineffective for membrane proteins

    • Solution: Use split-ubiquitin membrane yeast two-hybrid or proximity labeling techniques (BioID, APEX)

  • Temporal dynamics limitations:

    • Difficult to capture transient interactions during membrane trafficking

    • Solution: Implement optogenetic approaches and super-resolution live imaging techniques

  • Biochemical characterization challenges:

    • Detergent-based purification may disrupt native interactions

    • Solution: Utilize nanodiscs or native mass spectrometry to maintain membrane environment

Addressing these limitations requires integrating multiple complementary approaches and developing new methodologies specifically adapted to plant membrane trafficking proteins.

How does Arabidopsis SCAMP1 function compare with SCAMPs from other species?

Comparative analysis of SCAMP1 across species reveals important evolutionary and functional insights:

SpeciesSCAMP VariantSize (kDa)Distinctive FeaturesCellular Localization
Arabidopsis thalianaSCAMP132-38Complete N-terminal domain with NPF repeatsSecretory vesicles, plasma membrane
HumanSCAMP132-38Three isoforms identified (alternative splicing)Secretory vesicles, recycling endosomes
RatScamp132-38Similar to human SCAMP1Secretory granules
Rice (Oryza sativa)SCAMP132-38Putative functions in stress responsePlasma membrane, endosomes
MammalianSCAMP4~25Lacks most of N-terminal domainSimilar to other SCAMPs

The core membrane-spanning regions show the highest conservation, suggesting this domain is critical for the basic functions of SCAMP proteins . The differential expression patterns and regulatory mechanisms of SCAMPs across species indicate specialized adaptations to particular cellular environments, while maintaining fundamental trafficking functions.

Functional complementation studies have shown that some functions of SCAMP proteins are conserved across kingdoms, while others have evolved specifically in plant or animal lineages. This makes comparative studies particularly valuable for understanding both universal and species-specific aspects of membrane trafficking.

What experimental approaches can resolve contradictory data regarding SCAMP1 functions?

Resolving contradictory findings about SCAMP1 functions requires systematic experimental approaches:

  • Standardize experimental conditions:

    • Establish consensus protocols for expression systems

    • Define standardized assays for measuring specific SCAMP1 functions

    • Control for post-translational modifications that may affect function

  • Implement multi-model validation:

    • Conduct parallel studies in different model systems (cell lines, plant tissues)

    • Compare results between in vitro reconstitution and in vivo analyses

    • Utilize both gain-of-function and loss-of-function approaches

  • Apply advanced structural studies:

    • Cryo-EM analysis of SCAMP1 in membrane environments

    • Cross-linking mass spectrometry to identify interaction domains

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Develop temporal resolution methods:

    • Implement photoswitchable proteins to track SCAMP1 dynamics

    • Use fast-acting chemical dimerizers to induce SCAMP1 interactions

    • Apply single-molecule imaging techniques to capture transient events

These approaches collectively provide multiple lines of evidence that can help resolve seemingly contradictory results by identifying context-dependent functions or methodological artifacts.

How can researchers study post-translational modifications of SCAMP1 and their impact on function?

Post-translational modifications (PTMs) can significantly influence SCAMP1 function. A comprehensive approach to studying SCAMP1 PTMs includes:

  • Identification of modification sites:

    • Mass spectrometry analysis of purified SCAMP1

    • Enrichment techniques for specific modifications (phosphopeptides, glycopeptides)

    • Comparison of modifications across different physiological conditions

  • Functional validation:

    • Site-directed mutagenesis of identified modification sites

    • Creation of phosphomimetic mutations (S/T to D/E) or non-modifiable variants (S/T to A)

    • In vivo complementation assays with modified variants

  • Temporal dynamics:

    • Pulse-chase labeling to track modification kinetics

    • Identification of modifying enzymes through proximity labeling

    • Correlation of modifications with cellular responses to stimuli

  • Structural impact assessment:

    • Molecular dynamics simulations of modified protein variants

    • Circular dichroism to detect conformational changes

    • Limited proteolysis to reveal accessibility changes upon modification

These approaches can be combined to develop a comprehensive understanding of how PTMs regulate SCAMP1 function in different cellular contexts and in response to various stimuli.

What are the optimal antibody validation procedures for SCAMP1 detection in Arabidopsis?

Rigorous antibody validation is critical for reliable SCAMP1 detection. The optimal validation process includes:

  • Initial validation requirements:

    • Western blot analysis showing a band of appropriate molecular weight (32-38 kDa for Arabidopsis SCAMP1)

    • Comparison with negative controls (knockout or knockdown lines)

    • Cross-reactivity testing with recombinant protein

  • Application-specific validation:

    • For immunohistochemistry: parallel staining with multiple antibodies targeting different epitopes

    • For immunoprecipitation: mass spectrometry confirmation of pulled-down proteins

    • For ELISA: standard curves using recombinant protein at known concentrations

  • Reproducibility testing:

    • Inter-laboratory validation using standardized protocols

    • Lot-to-lot comparison for consistent performance

    • Antibody performance across different sample preparation methods

Available antibodies for Arabidopsis SCAMP1 include rabbit polyclonal antibodies that have been affinity-purified and validated for Western blotting and ELISA applications . The specificity of these antibodies should be regularly verified, especially when used in novel experimental contexts.

What are the most effective expression systems for producing functional recombinant SCAMP1?

The choice of expression system significantly impacts the quality and functionality of recombinant SCAMP1. A comparative analysis reveals:

Expression SystemYieldFunctionalityTechnical ConsiderationsApplications
E. coliHighLimitedOften forms inclusion bodies; requires refoldingStructural studies, antibody production
YeastModerateGoodBetter folding; some PTMs presentInteraction studies, functional assays
BaculovirusModerate-HighVery goodMore complex system; excellent for membrane proteinsStructural biology, functional characterization
Mammalian CellLow-ModerateExcellentMost authentic PTMs; technically demandingTrafficking studies, interaction analyses
Cell-Free ExpressionVariableVariableRapid; useful for difficult proteinsPreliminary studies, rapid screening
  • Required protein modifications

  • Intended experimental applications

  • Quantity needed

  • Time and resource constraints

In cases where protein-lipid interactions are critical to study, expression systems that maintain the native membrane environment (such as nanodiscs or microsomes) may be preferable despite potentially lower yields.

How can researchers effectively design CRISPR/Cas9 experiments to study SCAMP1 function?

CRISPR/Cas9 technology offers powerful approaches for studying SCAMP1 function in Arabidopsis. An effective experimental design includes:

  • Target selection strategy:

    • Design sgRNAs targeting conserved regions within the membrane core domain

    • Create multiple guide RNAs to increase editing efficiency

    • Consider targeting regions that are less likely to affect neighboring genes

  • Validation protocols:

    • PCR amplification and sequencing of target regions

    • Western blotting to confirm protein knockout

    • RT-qPCR to assess transcript levels

  • Phenotypic analysis:

    • Cellular trafficking assays using fluorescent cargo proteins

    • Membrane organization studies using lipid-binding dyes

    • Stress response and growth phenotype characterization

  • Advanced functional genomic approaches:

    • Generation of domain-specific mutations rather than complete knockouts

    • Creation of tagged endogenous SCAMP1 for live imaging

    • Development of inducible CRISPR interference systems for temporal control

When implementing CRISPR/Cas9 approaches for SCAMP1 study, researchers should consider potential functional redundancy within the SCAMP family and design experiments that can distinguish between specific and general SCAMP functions in Arabidopsis.

What emerging technologies hold promise for advancing SCAMP1 research?

Several cutting-edge technologies are poised to significantly advance SCAMP1 research:

  • Cryo-electron tomography:

    • Allows visualization of SCAMP1 in its native membrane environment

    • Can reveal structural details of SCAMP1-containing trafficking complexes

    • Provides insights into conformational changes during trafficking events

  • Proximity-dependent biotinylation approaches:

    • TurboID or BioID fusions to identify transient interaction partners

    • Spatial and temporal mapping of SCAMP1 interactome

    • Identification of compartment-specific interactions

  • Artificial intelligence for imaging analysis:

    • Deep learning algorithms for automated vesicle tracking

    • Pattern recognition for identifying trafficking defects in mutants

    • Predictive modeling of SCAMP1 functions based on localization patterns

  • Single-cell transcriptomics and proteomics:

    • Cell-type specific expression patterns of SCAMP1

    • Correlation of SCAMP1 levels with other trafficking components

    • Identification of regulatory networks controlling SCAMP expression

These technologies, when combined with existing approaches, will provide unprecedented insights into the molecular mechanisms underlying SCAMP1 function in membrane trafficking.

How might understanding SCAMP1 function contribute to broader plant biology knowledge?

SCAMP1 research has significant implications for multiple areas of plant biology:

  • Cellular stress responses:

    • SCAMP1's role in membrane remodeling during stress

    • Potential involvement in plant immune responses

    • Contribution to abiotic stress tolerance mechanisms

  • Plant development:

    • Regulation of polarized growth through directed vesicle trafficking

    • Role in hormone transport and signaling

    • Contribution to cell wall remodeling during growth

  • Evolutionary cell biology:

    • Insights into conserved trafficking mechanisms across eukaryotes

    • Understanding plant-specific adaptations in membrane trafficking

    • Elucidation of fundamental principles in organelle evolution

  • Agricultural applications:

    • Target for enhancing stress tolerance in crops

    • Understanding membrane trafficking components affecting yield

    • Potential role in pathogen resistance mechanisms

As a conserved component of the membrane trafficking machinery, SCAMP1 research connects fundamental mechanisms to applied aspects of plant biology, offering both basic insights and potential applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.