Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 2 (SCAMP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCAMP2; SC2; At1g03550; F21B7.17; Secretory carrier-associated membrane protein 2; AtSC2; Secretory carrier membrane protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SCAMP2
Target Protein Sequence
MARHDPNPFADEEINPFANHTSVPPASNSYLKPLPPEPYDRGATVDIPLDSGNDLRAKEM ELQAKENELKRKEQELKRREDAIARTGVVIEEKNWPEFFPLIHHDIPNEIPIHLQKIQYV AFTTLLGLVGCLLWNIVAVTVAWIKGEGPTIWLLSIIYFLAGVPGAYVLWYRPLYRATRT DSALKFGAFFFFYVFHIAFCGFAAVAPPVIFQGKSLTGFLPAIELLTTNAAVGIMYFIGA GFFCIETLLNIWVIQQVYAYFRGSGKAAEMKREATKSTLMRAL
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 2 (SCAMP2) from Arabidopsis thaliana is likely involved in membrane trafficking.
Database Links

KEGG: ath:AT1G03550

STRING: 3702.AT1G03550.1

UniGene: At.42538

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is SCAMP2 and what is its primary function in plant cells?

SCAMP2 (Secretory carrier membrane protein 2) is a transmembrane protein that plays a crucial role in vesicle trafficking between the Golgi apparatus and plasma membrane (PM) in plant cells. It functions as a marker for secretory vesicles and is involved in both exocytotic and endocytotic pathways. SCAMP2 is essential for cellular processes including cell division and expansion, as it participates in the transport of lipids, proteins, and polysaccharides that are synthesized and/or modified in the Golgi apparatus to the plasma membrane or extracellular space . Recent studies have identified SCAMP2 as a key component in a unique transport mechanism that involves secretory vesicle clusters (SVCs), which function as intermediate organelles between the trans-Golgi network (TGN) and plasma membrane .

How does SCAMP2 differ from other members of the SCAMP family?

SCAMP2 belongs to a family of membrane proteins that includes other members like SCAMP1. While both SCAMP1 and SCAMP2 are involved in vesicular trafficking pathways, they exhibit distinct localization patterns and transport dynamics. SCAMP1 localizes to the plasma membrane and clathrin-coated tubular-vesicular structures (likely early endosomal compartments), whereas SCAMP2 is found in the TGN, plasma membrane, cell plate, and the previously uncharacterized SVC organelles . Their endocytotic processes also differ, with each protein being internalized into distinct compartments. This suggests that these proteins may participate in different transport pathways within the plant endomembrane system, potentially providing specificity for different cargo molecules .

What is the secretory vesicle cluster (SVC) and how is it related to SCAMP2?

The secretory vesicle cluster (SVC) is a previously undescribed mobile structure involved in mass transport from the Golgi apparatus to the plasma membrane and cell plate in plant cells. It was identified through the analysis of SCAMP2 localization and trafficking patterns in tobacco BY-2 cells . The SVC is generated from the TGN as an immature structure that matures by budding clathrin-coated vesicles (CCVs) during transport. Eventually, the mature SVC fuses with the plasma membrane and/or expanding cell plate during cell division . SCAMP2 serves as a specific marker for the SVC, enabling researchers to track this transport structure using fluorescent protein tags. The identification of SVCs through SCAMP2 studies has significantly advanced our understanding of the complexity of exocytotic pathways in plant cells .

How is SCAMP2 transported between cellular compartments?

SCAMP2 undergoes dynamic cycling between multiple cellular compartments. It is exported from the trans-Golgi network to the plasma membrane via secretory vesicle clusters (SVCs) and then recycled back from the plasma membrane to intracellular compartments via the acto-myosin pathway . Studies using the photoswitchable fluorescent protein Dronpa1 fused to SCAMP2 have demonstrated that SCAMP2 on the plasma membrane is internalized into the cell within minutes without spreading laterally along the membrane. This observation confirms that SCAMP2 actively participates in endocytotic recycling processes . Interestingly, SCAMP2 does not transport FM4-64 positive early endosomes during this recycling, suggesting that it may be directly transported to the TGN or Golgi without passing through early endosomal compartments .

What techniques can be used to study SCAMP2 localization during cell division?

Multiple advanced imaging techniques have been employed to study SCAMP2 localization during cell division. These include:

  • Fluorescent protein tagging (with YFP, mRFP, or photoswitchable Dronpa1) to visualize SCAMP2 in living cells

  • Four-dimensional confocal laser scanning microscopy to track SCAMP2 movement over time

  • Total internal reflection fluorescence microscopy to observe SCAMP2 at the cell surface

  • Immunoelectron microscopy using specific antibodies against SCAMP2

  • Photoswitching experiments with Dronpa1-tagged SCAMP2 to trace protein movement from specific cellular locations

During cytokinesis, researchers have observed that SCAMP2 is transported to the expanding cell plate where cell wall materials and membrane proteins accumulate. By selectively activating SCAMP2-Dronpa fluorescence on the cell plate and tracking its movement, studies have shown that SCAMP2 is subsequently transported from the cell plate back to intracellular structures within daughter cells, providing evidence for recycling during cell division .

How does SCAMP2 trafficking relate to clathrin-coated vesicles (CCVs) in plant cells?

SCAMP2 trafficking is intimately connected with clathrin-coated vesicles (CCVs) in plant cells. Electron microscopy and tomographic observations have revealed that CCVs are present in both the cell plate and other regions of plant cells, particularly in association with early and late TGNs . The maturation process of SVCs, which contain SCAMP2, involves the budding of CCVs. Specifically, immature SVCs (which might be identical to late TGN) are converted to mature SVCs through this CCV budding process . After the mature SVC fuses with the plasma membrane or expanding cell plate, CCVs are generated to recycle SCAMP2 and other molecules back to intracellular compartments or daughter cells. This relationship between SCAMP2-positive structures and clathrin-mediated trafficking highlights the complex coordination between exocytotic and endocytotic pathways in plant cells .

What are the optimal expression systems for producing recombinant Arabidopsis thaliana SCAMP2?

For researchers working with recombinant Arabidopsis thaliana SCAMP2, several expression systems have proven effective, each with specific advantages depending on research objectives:

Bacterial Expression Systems:

  • E. coli systems (particularly BL21 strains) can be used for producing recombinant SCAMP2 fragments, though membrane proteins may form inclusion bodies requiring refolding

  • Codon optimization for bacterial expression is often necessary to improve yield

  • Typically includes His-tags or GST-tags for purification purposes

Plant-Based Expression Systems:

  • Tobacco BY-2 suspension cells have been successfully used for expressing SCAMP2 with fluorescent protein tags

  • Arabidopsis protoplast transient expression allows for rapid analysis of protein localization

  • Transgenic Arabidopsis plants with tagged SCAMP2 under native or 35S promoters provide in vivo expression in the native organism

When expressing SCAMP2 for localization studies, fusion with fluorescent proteins such as YFP, mRFP, or the photoswitchable Dronpa1 has proven highly effective for tracking protein dynamics in living cells . For immunological detection, expressing epitope-tagged versions (HA, c-Myc, or FLAG tags) can facilitate detection with commercially available antibodies.

What methodological approaches are most effective for studying SCAMP2 trafficking dynamics?

Several complementary methodological approaches have proven effective for investigating SCAMP2 trafficking dynamics:

Live-Cell Imaging Techniques:

  • Four-dimensional confocal laser scanning microscopy for tracking SCAMP2 movement over time

  • Total internal reflection fluorescence microscopy (TIRFM) for visualizing near-membrane events

  • Photoswitching experiments using Dronpa1-tagged SCAMP2 to trace protein movement from specific cellular locations

  • Dual-color imaging with markers for different compartments (e.g., YFP-SYP41 for TGN)

Pharmacological Approaches:

  • Brefeldin A (BFA) treatment to inhibit transport vesicle formation (5 μg/mL has been shown effective)

  • Wortmannin treatment to inhibit phosphatidylinositol-related pathways

  • Actin-disrupting agents to assess acto-myosin dependence of trafficking

Biochemical and Molecular Techniques:

  • Subcellular fractionation on sucrose gradients to isolate membrane compartments containing SCAMP2

  • Immunoprecipitation to identify interacting partners

  • RNA interference or CRISPR-based gene editing to assess loss-of-function effects

A particularly powerful approach combines the photoswitchable Dronpa1 fusion with live-cell imaging to trace SCAMP2 movement from specific cellular locations such as the plasma membrane or cell plate, allowing precise tracking of protein recycling pathways .

How can researchers differentiate between the various SCAMP2-positive compartments in plant cells?

Differentiating between various SCAMP2-positive compartments requires combining multiple techniques and markers:

Co-localization with Compartment-Specific Markers:

  • SYP41 for trans-Golgi network/TGN (91% ± 3% co-localization with SCAMP2)

  • SYP22 for multivesicular bodies/prevacuolar compartments

  • FM4-64 dye at different time points (30-40 minutes for TGN labeling)

  • Specific lipid markers like PH domain proteins for Golgi apparatus

Morphological and Behavioral Characteristics:

  • SVCs appear as clustered vesicular structures distinct from individual transport vesicles

  • TGN-localized SCAMP2 appears as punctate structures often associated with Golgi cisternae

  • PM-localized SCAMP2 shows continuous labeling along the cell surface

  • Cell plate-localized SCAMP2 is found in the developing cell plate during cytokinesis

Response to Inhibitors:

  • BFA treatment (5 μg/mL, 2 hours) redistributes SCAMP2 predominantly to the plasma membrane while Golgi markers move to the ER

  • Wortmannin effects can distinguish PI3K-dependent compartments

  • Actin inhibitors block recycling from the plasma membrane but not initial secretion

The combination of these approaches allows researchers to precisely identify the subcellular location of SCAMP2 in different experimental contexts and developmental stages.

How should researchers interpret conflicting SCAMP2 localization data?

When faced with conflicting SCAMP2 localization data, researchers should implement a systematic analytical approach:

Potential Sources of Discrepancy:

  • Tag interference: Different fluorescent protein tags may affect SCAMP2 trafficking differently

  • Expression levels: Overexpression artifacts versus native expression patterns

  • Cell type differences: SCAMP2 localization may vary between different plant tissues or cell types

  • Temporal dynamics: SCAMP2 rapidly cycles between compartments, so timing of observation is critical

  • Resolution limitations: Different imaging techniques provide varying levels of resolution

Recommended Analytical Strategy:

  • Compare localization using multiple independent techniques (fluorescent tagging, immunolocalization, subcellular fractionation)

  • Validate with complementary approaches such as biochemical fractionation (as shown in the sucrose gradient analysis that detected SCAMP2 in both PM and Golgi fractions)

  • Use both C-terminal and N-terminal tags to account for potential interference with targeting signals

  • Compare results from transient expression versus stable transformation

  • Utilize native promoter-driven expression to avoid overexpression artifacts

  • Implement super-resolution microscopy techniques for enhanced spatial resolution

  • Perform time-course studies to capture the dynamic nature of SCAMP2 trafficking

When evaluating published results, it's important to note that the reported colocalization of SCAMP2 with TGN marker SYP41 (91% ± 3%) provides a quantitative benchmark for comparing new findings.

What considerations are important when designing experiments to study SCAMP2 function?

When designing experiments to investigate SCAMP2 function, researchers should consider:

Experimental Controls:

  • Include both positive controls (known cargo proteins) and negative controls (non-secreted proteins)

  • Compare SCAMP2 with other SCAMP family members (SCAMP1) to identify unique versus shared functions

  • Use untransformed cells alongside transgenic lines to control for expression effects

Genetic Approaches:

  • Loss-of-function strategies:

    • CRISPR/Cas9 gene editing

    • RNAi or antisense suppression

    • T-DNA insertion mutants (for Arabidopsis)

  • Gain-of-function approaches:

    • Domain-specific mutations to disrupt specific functions

    • Chimeric proteins to identify functional domains

    • Inducible overexpression systems

Cargo Transport Assays:

  • Track movement of known secretory cargoes such as:

    • Cell wall polysaccharides (pectins, hemicelluloses)

    • Secretory proteins with known trafficking patterns

    • PM-localized transporters or receptors

Physiological Readouts:

  • Cell expansion rates (as exocytosis is essential for cell growth)

  • Cell division progression and cell plate formation

  • Response to environmental stresses that may involve secretory pathways

Interaction Studies:

  • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

  • Co-immunoprecipitation with potential partners

  • Proximity labeling approaches (BioID, APEX) to identify the SCAMP2 interaction network

These considerations ensure robust experimental design that can distinguish between direct and indirect effects of SCAMP2 on cellular processes.

How can researchers quantitatively assess SCAMP2 trafficking dynamics?

Quantitative assessment of SCAMP2 trafficking dynamics requires sophisticated imaging and analytical approaches:

Imaging-Based Quantification Methods:

  • Fluorescence recovery after photobleaching (FRAP) to measure:

    • Mobile fraction of SCAMP2 in different compartments

    • Half-time of recovery as a measure of trafficking rates

  • Pulse-chase experiments with photoconvertible fluorescent proteins:

    • Activation of Dronpa1-tagged SCAMP2 at specific locations

    • Quantification of signal redistribution over time

  • Single-particle tracking to follow individual vesicles containing SCAMP2:

    • Velocity measurements

    • Directional persistence

    • Interaction frequency with target membranes

Analytical Framework:

  • Compartment residence time analysis:

    • Measure the dwell time of SCAMP2 in each compartment

    • Calculate the rate constants for transitions between compartments

  • Co-localization coefficients:

    • Pearson's correlation coefficient

    • Mander's overlap coefficient

    • Object-based colocalization for vesicular structures

  • Vesicular dynamics parameters:

    • Number and size distribution of SCAMP2-positive structures

    • Fusion and fission event frequency

    • Transport velocities along cytoskeletal elements

Quantitative Example from Literature:
Studies have reported that SCAMP2-Dronpa fluorescence activated on the plasma membrane moves into BY-2 cells within several minutes without spreading around the PM, providing a measurable timeframe for endocytotic events . Similarly, the colocalization between YFP-SYP41 and SCAMP2-mRFP has been quantified as 91% ± 3% , establishing a baseline for quantitative assessment of SCAMP2 compartmental distribution.

For rigorous analysis, researchers should combine these quantitative approaches with appropriate statistical testing and computational modeling to interpret the complex, dynamic behavior of SCAMP2 in plant cells.

How does Arabidopsis thaliana SCAMP2 compare to SCAMP2 homologs in other plant species?

Comparative analysis of SCAMP2 across plant species reveals both conserved and divergent features:

Sequence Conservation:
SCAMP2 proteins across plant species share a conserved domain architecture consisting of:

  • N-terminal domain with variable length and sequence

  • Four transmembrane domains (highly conserved)

  • Cytoplasmic regions between transmembrane domains containing NPF motifs

  • C-terminal tail with potential regulatory functions

While the core transmembrane regions show high conservation, the N-terminal and C-terminal domains exhibit greater variation, suggesting species-specific functional adaptations.

Functional Conservation:
SCAMP2 has been characterized in several plant systems including:

  • Tobacco (Nicotiana tabacum) BY-2 cells

  • Arabidopsis thaliana

  • Rice (Oryza sativa)

In all these species, SCAMP2 localizes to similar subcellular compartments (TGN, PM, and secretory vesicles), suggesting conserved trafficking functions across diverse plant lineages. The secretory vesicle cluster (SVC) structures marked by SCAMP2 have been observed in all these species, indicating that this trafficking mechanism is evolutionarily conserved in plants .

Species-Specific Differences:
Despite functional conservation, species-specific differences may include:

  • Expression patterns across tissues and developmental stages

  • Responsiveness to environmental cues

  • Association with specialized secretory processes (e.g., defense compound secretion)

  • Interaction with species-specific trafficking machinery components

These comparative insights help researchers understand the fundamental versus adaptable aspects of SCAMP2 function in plant secretory pathways.

What are the key differences between plant SCAMP2 and mammalian SCAMP homologs?

Plant and mammalian SCAMP proteins share core structural features but exhibit important functional and regulatory differences:

Structural Comparisons:

  • Both plant and mammalian SCAMPs have 4 transmembrane domains

  • Mammalian SCAMPs (particularly SCAMP1-3) contain a conserved N-terminal NPF repeat domain involved in endocytosis via interactions with EH domain proteins

  • Plant SCAMP2 proteins may contain fewer NPF motifs or have them distributed differently across the protein sequence

Functional Distinctions:

  • Mammalian SCAMPs (particularly SCAMP2) are implicated in regulated exocytosis in secretory cells

  • Plant SCAMP2 is uniquely associated with the SVC transport pathway, which has no direct counterpart in mammalian cells

  • Mammalian SCAMP2 has been implicated in diseases such as acute myeloid leukemia (AML), showing elevated expression levels in cancer cells

Regulatory Mechanisms:

  • Phosphorylation sites differ between plant and mammalian SCAMPs

  • Mammalian SCAMPs interact with specific exocyst components not conserved in plants

  • The recycling pathways following endocytosis appear to involve different compartments

This comparative understanding helps researchers interpret findings across kingdoms and identify plant-specific mechanisms that may have evolved to address unique cellular requirements in plant systems.

What are the most promising future research directions for SCAMP2 in plant cell biology?

Several promising research directions could significantly advance our understanding of SCAMP2 function in plant cells:

Molecular Interactions and Regulation:

  • Identification of the complete SCAMP2 interactome in different plant tissues and developmental stages

  • Characterization of post-translational modifications that regulate SCAMP2 trafficking

  • Determination of cargo specificity mechanisms: how SCAMP2-containing vesicles selectively transport specific cargo molecules

Advanced Imaging Applications:

  • Implementation of super-resolution microscopy techniques to resolve the fine structure of SVCs

  • Long-term 4D imaging of SCAMP2 throughout the complete cell cycle

  • Correlative light and electron microscopy to link dynamic behavior with ultrastructural details

Functional Genomics Approaches:

  • CRISPR-based genome editing to create targeted mutations in functional domains

  • Synthetic biology approaches to engineer SCAMP2 variants with novel trafficking properties

  • Multi-omics integration (proteomics, transcriptomics, metabolomics) to place SCAMP2 function in broader cellular context

Developmental and Stress-Response Roles:

  • Investigation of SCAMP2 function during specific developmental transitions

  • Analysis of SCAMP2 trafficking changes in response to biotic and abiotic stresses

  • Role of SCAMP2 in specialized cell types with high secretory activity (root hairs, trichomes, guard cells)

Biotechnological Applications:

  • Exploitation of SCAMP2 pathways for improved secretion of recombinant proteins in plant-based expression systems

  • Engineering SCAMP2 to enhance cell wall modification for bioenergy applications

  • Manipulation of SCAMP2 to alter plant resistance responses through modified secretion of defense compounds

These future directions would build upon the foundational knowledge that SCAMP2 functions in a novel secretory vesicle cluster (SVC) transport pathway between the TGN and plasma membrane, potentially revolutionizing our understanding of plant secretory processes .

What are the broader implications of SCAMP2 research for understanding plant cellular processes?

SCAMP2 research has revealed fundamental insights about plant cellular processes with far-reaching implications:

Endomembrane System Complexity:
The identification of the secretory vesicle cluster (SVC) through SCAMP2 studies has demonstrated that plant exocytotic pathways are more complex than previously thought. The presence of at least two distinct exocytotic mechanisms from the TGN suggests specialized trafficking routes for different cargo types . This complexity may provide plants with enhanced regulatory control over secretion processes essential for growth, development, and environmental responses.

Cell Division Mechanisms:
SCAMP2 trafficking during cytokinesis has revealed that membrane proteins delivered to the cell plate can be recycled back to daughter cells rather than being permanently incorporated into the new cell wall . This recycling mechanism has important implications for our understanding of how resources are conserved during plant cell division and how the composition of new cell membranes is regulated.

Evolutionary Adaptations:
The conservation of SCAMP2 and SVC structures across diverse plant species (Arabidopsis, tobacco, rice) suggests these represent fundamental adaptations in plant cellular organization . Understanding these plant-specific trafficking pathways provides insight into how plants have evolved unique solutions to the challenges of having a cell wall and maintaining turgor pressure.

Integration with Other Trafficking Pathways:
SCAMP2 research has highlighted connections between secretory and endocytic pathways, demonstrating how these processes are coordinated through shared machinery components. This integration is crucial for maintaining cellular homeostasis during growth and in response to environmental changes .

These broader implications establish SCAMP2 as a key component in our conceptual framework for understanding plant cellular organization and function.

How might SCAMP2 research contribute to agricultural or biotechnological applications?

SCAMP2 research has several potential applications in agriculture and biotechnology:

Crop Improvement Strategies:

  • Enhanced stress resistance through optimized secretory pathways:

    • Drought tolerance via improved cell wall modification

    • Pathogen resistance through faster secretion of defense compounds

  • Improved growth characteristics:

    • Optimized cell expansion through enhanced vesicle trafficking

    • Better nutrient utilization through modified membrane transporter delivery

Biotechnology Applications:

  • Improved plant-based production systems:

    • Enhanced secretion of recombinant proteins in molecular farming

    • Controlled delivery of engineered enzymes to specific subcellular locations

  • Bioenergy applications:

    • Modified cell wall composition for improved biofuel production

    • Enhanced secretion of cell wall-modifying enzymes

Diagnostic Tools:

  • Development of SCAMP2-based markers for cellular stress responses

  • Visualization tools for monitoring secretory pathway function in living plants

Synthetic Biology Approaches:

  • Engineering novel trafficking pathways using modified SCAMP2 proteins

  • Creation of artificial compartments for specialized metabolic processes

These applications leverage the fundamental role of SCAMP2 in secretory processes that underpin plant growth, development, and environmental responses. By understanding and manipulating these pathways, researchers can potentially develop crops with improved performance characteristics and novel biotechnological capabilities.

What methodological advances are needed to resolve current knowledge gaps in SCAMP2 research?

Several methodological advances would help address key knowledge gaps in SCAMP2 research:

Technical Innovations Needed:

  • Super-resolution imaging techniques optimized for plant cells to resolve:

    • Fine structure of SVCs and their maturation process

    • Nano-scale organization of SCAMP2 within membrane domains

    • Dynamic interactions between SVCs and target membranes

  • Improved protein tagging systems that:

    • Minimize interference with protein function

    • Allow orthogonal labeling of multiple SCAMP family members simultaneously

    • Enable temporal control of protein expression and degradation

  • Advanced mass spectrometry approaches for:

    • Identifying post-translational modifications of SCAMP2

    • Quantifying changes in the SCAMP2 interactome under different conditions

    • Determining the complete cargo repertoire of SCAMP2-positive vesicles

  • Computational tools for:

    • Tracking complex vesicle dynamics in 4D imaging datasets

    • Modeling the kinetics of SCAMP2 trafficking between compartments

    • Integrating multi-omics data to place SCAMP2 in broader cellular networks

Experimental Strategies to Implement:

  • Genetic resources development:

    • Complete set of SCAMP family mutants and fluorescent protein fusions

    • Inducible expression systems for acute manipulation of SCAMP2 levels

    • Domain-specific mutations to dissect protein function

  • Reconstitution systems:

    • In vitro vesicle formation assays with purified components

    • Cell-free systems to study SCAMP2 incorporation into membranes

    • Minimal systems to identify essential components for SVC formation

Addressing these methodological challenges would significantly advance our understanding of SCAMP2 function and potentially resolve current controversies regarding its precise role in plant secretory pathways.

Table 1: SCAMP2 Subcellular Localization and Colocalization with Compartment Markers

Subcellular CompartmentMarkerColocalization with SCAMP2Techniques UsedReference
Trans-Golgi NetworkYFP-SYP4191% ± 3%Confocal microscopy
Plasma MembraneFM4-64 (short-term)PartialConfocal microscopy
Secretory Vesicle ClusterSCAMP2-specificSelf-markerEM, 4D imaging
Cell PlateSCAMP2-DronpaTransient during divisionTime-lapse imaging
Multivesicular BodiesSYP22No colocalizationConfocal microscopy

Table 2: Comparative Expression of SCAMP Family Members in AML

SCAMP Family MemberFold Change in AMLDatasetp-valueReference
SCAMP1Higher (value not specified)Andersson's datasetSignificant
SCAMP22.219Andersson's datasetSignificant
SCAMP32.988Andersson's datasetSignificant
SCAMP4No data available--
SCAMP51.725Andersson's datasetSignificant

Table 3: Effects of Inhibitors on SCAMP2 Localization

InhibitorConcentrationTreatment DurationEffect on SCAMP2 LocalizationReference
Brefeldin A5 μg/mL2 hoursRedistribution to plasma membrane
Wortmannin10-100 μMNot specifiedInhibits phosphatidylinositol-related pathways
2,3-butanedione monoximeNot specifiedNot specifiedDisrupts acto-myosin pathway affecting SCAMP2 recycling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.