Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 3 (SCAMP3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Arabidopsis thaliana

SCAMP3 facilitates post-Golgi trafficking and endosomal sorting, impacting:

  • Vesicle Transport: Mediates secretory vesicle clustering and cargo delivery to the plasma membrane ( ).

  • Cell Wall Synthesis: Supports xylem development by transporting extracellular polysaccharides and cell wall precursors ( ).

  • Stress Response: Modulates membrane recycling under abiotic stress, though direct evidence in Arabidopsis requires further study ( ).

Evolutionary and Comparative Analysis

SCAMP3 is evolutionarily conserved across plants. A comparative study of SCAMP genes in A. thaliana, Populus trichocarpa, and Manihot esculenta revealed:

SpeciesSCAMP HomologsFunctional Overlap
A. thalianaSCAMP1-5Membrane trafficking, stress response
Hevea brasiliensisHbSCAMP3Xylem development, growth regulation
Oryza sativaOsSCAMP3Vesicle-mediated transport

SCAMP3 homologs in woody plants (e.g., rubber tree) show stronger evolutionary ties to A. thaliana than herbaceous species ( ).

Subcellular Localization

  • SCAMP3 localizes to the plasma membrane and secretory vesicles in tobacco epidermal cells, suggesting conserved trafficking roles ( ).

  • Interacts with ER–Golgi–TGN–PM pathways, dependent on N-terminal domains ( ).

Functional Knockdown Studies

  • Reduced SCAMP3 expression in Arabidopsis mutants correlates with impaired vesicle clustering and slowed growth ( ).

  • Regulatory Pathways: Associates with oxidative phosphorylation and chromatin remodeling networks ( ).

Applications in Plant Biology

ApplicationRelevanceCitation
Protein TraffickingModel for studying post-Golgi sorting and vesicle dynamics
Genetic EngineeringOverexpression/mutation studies to dissect membrane transport mechanisms
Biotechnological ToolsMarker for secretory vesicles in live-cell imaging

Future Directions

  • Mechanistic Studies: Elucidate SCAMP3’s role in stress signaling and pathogen interactions ( ).

  • Crop Engineering: Leverage SCAMP3 homologs to enhance nutrient transport in economically important plants ( ).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development according to your specifications.
Synonyms
SCAMP3; SC3; At1g61250; F11P17.4; Secretory carrier-associated membrane protein 3; AtSC3; Secretory carrier membrane protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SCAMP3
Target Protein Sequence
MANRYDPNPFAEEEEVNPFANARGVPPASNSRLSPLPPEPVGFDYGRTVDIPLDRAGTQD LKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIPVHL QRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWYRPL YRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAIVGI FYFIGFAFFCLESVVSIWVIQQVYMYFRGSGKQDQMRREAARGALRAAV
Uniprot No.

Target Background

Function
This protein is likely involved in membrane trafficking.
Database Links

KEGG: ath:AT1G61250

STRING: 3702.AT1G61250.1

UniGene: At.19956

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.