Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 4 (SCAMP4)

Shipped with Ice Packs
In Stock

Description

Production and Purification

SCAMP4 is expressed in Escherichia coli and purified via affinity chromatography due to its His-tag. Key production parameters:

ParameterDetailsSource
HostE. coli
Purity>90% (SDS-PAGE-verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage-20°C/-80°C; avoid freeze-thaw cycles

Reconstituted solutions are stabilized with 5–50% glycerol for long-term storage .

Membrane Topology

SCAMP4 adopts a four-transmembrane-span topology, with cytoplasmic N- and C-terminal domains flanking the membrane core . Limited proteolysis studies confirm its orientation, with conserved amphiphilic segments stabilizing membrane interactions .

Role in Membrane Trafficking

While SCAMP4 lacks the N-terminal regulatory domains of larger SCAMPs (e.g., SCAMP1), its conserved membrane core suggests a core functional role. In mammals, SCAMP4 enhances senescence-associated secretory phenotype (SASP) by promoting cytokine secretion , though plant-specific studies remain limited.

Diagnostic Tools

An ELISA kit (CSB-EP863220DOA) is available for detecting SCAMP4 in Arabidopsis extracts, enabling quantitative analysis of protein expression .

Challenges and Considerations

  • Stability: SCAMP4 requires careful handling to prevent aggregation. Repeated freeze-thaw cycles degrade activity .

  • Host Limitations: While Arabidopsis-based systems improve post-translational modifications, SCAMP4 is typically produced in E. coli due to scalability .

Comparative Analysis of SCAMP4 and Other SCAMPs

FeatureSCAMP4SCAMP1 (Mammalian)SCAMP4 (Plant)
Size~25 kDa~32–38 kDa~25 kDa (full-length in Arabidopsis)
N-terminal domainMinimalContains NPF repeats + proline motifsAbsent
FunctionMembrane trafficking (core domain)Regulated exocytosis/endocytosisStructural studies of trafficking

Data synthesized from .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SCAMP4; At1g32050; T12O21.5; Secretory carrier-associated membrane protein 4; Secretory carrier membrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SCAMP4
Target Protein Sequence
MNRHHDPNPFDEDEEIVNPFSKGGGRVPAASRPVEYGQSLDATVDIPLDNMNDSSQKQRK LADWEAELRKKEMDIKRREEAIAKFGVQIDDKNWPPFFPIIHHDIAKEIPVHAQKLQYLA FASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPLYRAMRTD SALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAIDVISDSLLAGIFYFIGFG LFCLESLLSLWVLQKIYLYFRGNK
Uniprot No.

Target Background

Function

Likely involved in membrane trafficking.

Database Links

KEGG: ath:AT1G32050

STRING: 3702.AT1G32050.1

UniGene: At.43052

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of SCAMP4 and how does it differ from other SCAMP family members?

SCAMP4 belongs to a conserved family of integral membrane proteins involved in membrane trafficking. Unlike SCAMP1-3, which contain N-terminal NPF (Arg-Pro-Phe) repeats, SCAMP4 lacks these cytoplasmic repeats . The SCAMP family shares several structural motifs:

SCAMP TypeMolecular WeightN-terminal NPF RepeatsTransmembrane DomainsPrimary Localization
SCAMP1-332-38 kDaPresentFourGolgi/plasma membrane
SCAMP4~25 kDaAbsentFourPlasma membrane
SCAMP5~25 kDaAbsentFourPlasma membrane

Methodologically, structural differences between SCAMPs can be verified through hydropathy analysis, Western blotting with domain-specific antibodies, and limited proteolysis experiments to identify protease-resistant domains . When studying A. thaliana SCAMP4, researchers should note it contains the conserved membrane core with four transmembrane spans that represents the minimal functional unit of the SCAMP family .

What are the recommended methods for storing recombinant A. thaliana SCAMP4?

For optimal stability and activity of recombinant A. thaliana SCAMP4, follow these evidence-based storage protocols:

  • Reconstitute the lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Store aliquoted protein at -20°C/-80°C (liquid form: 6 months shelf life; lyophilized form: 12 months shelf life)

  • Store working aliquots at 4°C for no more than one week

  • Avoid repeated freezing and thawing cycles

When assessing protein stability after storage, run SDS-PAGE to verify integrity, particularly since membrane proteins like SCAMP4 can aggregate during freeze-thaw cycles. For functional experiments, always use freshly thawed aliquots.

What expression systems are most effective for producing recombinant A. thaliana SCAMP4?

Based on available research, recombinant A. thaliana SCAMP4 has been successfully produced in mammalian cell expression systems . When designing an expression strategy:

  • Codon-optimize the sequence for your expression system

  • Consider using a fusion tag for easier purification and detection (tag type may be determined during the manufacturing process)

  • For membrane proteins like SCAMP4, expression systems that allow proper membrane insertion are critical

For plant-based functional studies, consider:

  • Transient expression in Nicotiana benthamiana

  • Stable transformation of Arabidopsis for in vivo localization and interaction studies

  • Cell-free expression systems for initial protein characterization

Validation methods should include Western blot analysis and verification of proper membrane localization through fractionation studies or microscopy with fluorescent tags .

How can researchers experimentally determine SCAMP4 membrane topology?

To map the membrane topology of A. thaliana SCAMP4, adapt these methodological approaches used for mammalian SCAMPs:

  • Alkaline Phosphatase (PhoA) fusion strategy:

    • Generate truncated SCAMP4 constructs fused to PhoA

    • Express in E. coli strain UT5600

    • Measure enzymatic activity (PhoA is only active when localized to the periplasm, indicating extracellular orientation)

    • This approach revealed that mammalian SCAMP1 has four transmembrane domains with cytoplasmic N- and C-termini

  • Limited proteolysis with isolated membrane vesicles:

    • Prepare uniformly oriented membrane vesicles containing SCAMP4

    • Treat with proteases (e.g., trypsin)

    • Analyze protected fragments by Western blotting with domain-specific antibodies

    • This approach identified a ~20 kDa protease-resistant membrane core in SCAMP1

  • Synthetic peptide binding studies:

    • Synthesize peptides corresponding to putative amphiphilic segments

    • Assess membrane binding through techniques like circular dichroism spectroscopy

    • Similar studies with SCAMP1 demonstrated that the central amphiphilic segment between transmembrane spans 2 and 3 adopts an α-helical structure

The predicted topology for SCAMP4 would include four transmembrane spans with cytoplasmic N- and C-termini, as observed in other family members .

What is known about SCAMP4's evolutionary conservation across species?

SCAMP proteins represent a broadly conserved family spanning the plant and animal kingdoms, though no obvious fungal homologues have been identified . Evolutionary analysis reveals:

  • SCAMPs have been found in diverse species including:

    • Mammals (rat, mouse, human)

    • Invertebrates (C. elegans, D. melanogaster)

    • Plants (A. thaliana, pea, rice)

  • The membrane core containing four transmembrane spans and three amphiphilic segments represents the most highly conserved structural element

  • A. thaliana contains multiple SCAMP family members, with SCAMP4 encoded by gene AT1G03550 (also annotated as AT1G32050)

To study evolutionary relationships, conduct:

  • Multiple sequence alignments of SCAMP4 sequences from different species

  • Phylogenetic analysis to determine divergence patterns

  • Complementation studies to test functional conservation (e.g., can plant SCAMP4 rescue phenotypes in mammalian cells lacking SCAMP4?)

The high conservation suggests critical functional importance, particularly of the membrane core which is present in all family members including the shorter SCAMP4 .

What methods can be used to verify the functionality of recombinant A. thaliana SCAMP4?

To confirm that recombinant A. thaliana SCAMP4 is properly folded and functional:

  • Membrane binding assays:

    • Verify membrane association through subcellular fractionation

    • Confirm resistance to alkaline carbonate extraction (characteristic of integral membrane proteins)

    • Test Triton X-114 phase separation (membrane proteins partition into the detergent phase)

  • Vesicle trafficking assays:

    • Monitor secretion of reporter proteins in plant cells overexpressing or silenced for SCAMP4

    • This approach revealed that mammalian SCAMP4 enhances secretion of factors like IL6, IL8, and GDF-15

  • Complementation studies:

    • Express A. thaliana SCAMP4 in plant cells with silenced endogenous SCAMP4

    • Assess rescue of trafficking/secretion phenotypes

    • Similar approaches with mammalian SCAMP4 demonstrated functional relevance

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to identify binding partners

    • Verify interactions with expected components of the trafficking machinery

    • In mammalian systems, SCAMP5 interacts with SNARE proteins to regulate secretion

Functional assays should be tailored to the specific biological context you're studying, with appropriate positive and negative controls.

What is the relationship between SCAMP4 and cellular senescence in plants?

Studies in mammalian systems have revealed a striking relationship between SCAMP4 and cellular senescence that may have parallels in plant biology:

  • Mammalian SCAMP4 in senescence:

    • SCAMP4 is highly abundant on the surface of senescent cells but not proliferating cells

    • It promotes secretion of senescence-associated secretory phenotype (SASP) factors

    • SCAMP4 protein is rapidly degraded by the ubiquitin-proteasome pathway in proliferating cells but stabilized in senescent cells

  • Potential research questions for plant SCAMP4:

    • Does A. thaliana SCAMP4 show altered expression or stability during leaf senescence?

    • Can SCAMP4 modulate secretion of senescence-associated proteins in plants?

    • Is plant SCAMP4 also regulated post-translationally via the ubiquitin-proteasome system?

  • Experimental approaches:

    • Compare SCAMP4 levels in young versus senescing leaves using Western blot and immunofluorescence

    • Analyze SCAMP4 ubiquitination and turnover rates across developmental stages

    • Monitor secreted proteome changes in plants with modified SCAMP4

    • Perform transcriptome analysis to detect correlations between SCAMP4 and senescence-associated genes

The potential connection between SCAMP4 and plant senescence represents an unexplored area that could yield insights into evolutionary conservation of senescence mechanisms.

What methodological challenges exist in studying membrane-localized SCAMP4 function?

Studying membrane proteins like SCAMP4 presents several technical challenges that require specialized approaches:

  • Protein purification and structural characterization:

    • Membrane proteins are difficult to solubilize while maintaining native conformation

    • Use mild detergents or amphipols for extraction

    • Consider nanodiscs or liposomes for reconstitution studies

    • For structural studies, cryo-EM may be more suitable than crystallography

  • Functional reconstitution:

    • Demonstrating functionality after purification is challenging

    • Develop liposome-based assays to test membrane fusion or transport activities

    • For plant SCAMP4, consider plant-derived membrane mimetics for more native-like environment

  • Localization studies in plants:

    • Plant cell walls complicate immunolabeling of membrane proteins

    • Optimize fixation and permeabilization protocols (methanol fixation without permeabilization preserved plasma membrane integrity for mammalian SCAMP4 detection)

    • Use both N- and C-terminal tags to ensure proper topology interpretation

    • Controls should include markers for different membrane compartments

  • Specific challenges for A. thaliana SCAMP4:

    • Limited availability of specific antibodies

    • Cell wall interference with membrane protein accessibility

    • Need to distinguish between different SCAMP family members

    • Potential redundancy requiring multiple gene silencing

Address these challenges by combining complementary approaches and developing plant-specific protocols adapted from successful mammalian studies.

How might SCAMP4 interact with the plant immune response pathway?

While direct evidence for SCAMP4's role in plant immunity is not provided in the search results, its function in membrane trafficking suggests potential involvement in immune responses:

  • Potential roles in plant immunity:

    • Secretion of antimicrobial compounds during pathogen attack

    • Trafficking of pattern recognition receptors to the plasma membrane

    • Regulation of exocytosis during cell wall reinforcement

    • Modulation of hormone transport during systemic acquired resistance

  • Experimental approaches:

    • Challenge SCAMP4-overexpressing or silenced plants with pathogens

    • Monitor trafficking of defense-related proteins during infection

    • Analyze co-localization with known immune components during pathogen perception

    • Perform co-immunoprecipitation studies to identify interactions with immune receptors

  • Technical considerations:

    • Use both biotrophic and necrotrophic pathogens in challenge experiments

    • Include appropriate positive controls (known defense mutants)

    • Combine biochemical approaches with genetic studies

    • Consider cell-specific responses using tissue-specific promoters

This research direction could reveal novel connections between membrane trafficking machinery and plant defense responses, potentially identifying new targets for improving crop resistance to pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.