Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 5 (SCAMP5)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems for SCAMP5

Recombinant Arabidopsis thaliana SCAMP5 refers to the artificial production of the SCAMP5 protein using molecular biology techniques in laboratory settings. The recombinant protein is typically expressed in heterologous systems such as bacterial cultures (predominantly Escherichia coli) or other eukaryotic expression systems.

Standard commercial recombinant SCAMP5 preparations are available with specific characteristics:

  • Quantity: Typically provided as 50 μg, with other quantities available on request

  • Storage buffer: Usually preserved in Tris-based buffer with 50% glycerol, optimized for protein stability

  • Storage conditions: Recommended storage at -20°C, with extended storage at -20°C or -80°C

  • Usage guidance: Repeated freezing and thawing is not recommended, with working aliquots best kept at 4°C for up to one week

Membrane-Spanning Regions

SCAMP5 is characterized by multiple transmembrane domains that anchor the protein within cellular membranes. These hydrophobic regions enable the protein to function as a component of the cellular membrane trafficking machinery .

Membrane Trafficking

SCAMP5 plays a crucial role in the endomembrane system of Arabidopsis thaliana. As part of the secretory carrier membrane protein family, it participates in various membrane trafficking pathways that are essential for cellular function .

Interaction with TPLATE Complex

Research has revealed that SCAMP5 interacts with subunits of the endocytic TPLATE complex (TPC), suggesting a role in endocytosis. This interaction potentially regulates the internalization of plasma membrane proteins and contributes to cellular responses to environmental stimuli .

Role in Water Homeostasis

SCAMP5 has been identified as an interactor with Plasma Membrane Intrinsic Proteins (PIPs), which function as water channels in plant cells. Mutants lacking functional SCAMP proteins (scamp mutants) exhibit a drought-tolerant phenotype, indicating that SCAMP5 may play a role in water homeostasis regulation through its interaction with PIPs .

Subcellular Localization Function

Experimental evidence suggests that SCAMP5 influences the subcellular localization of other proteins, particularly PIP2;1. In scamp mutants, defects in the subcellular localization of mCherry-tagged PIP2;1 have been observed, highlighting SCAMP5's role in trafficking and proper positioning of membrane proteins .

Protein-Protein Interaction Studies

Recombinant SCAMP5 serves as a valuable tool for investigating protein-protein interactions in membrane trafficking pathways. Researchers can use purified recombinant SCAMP5 for:

  • In vitro binding assays to identify interaction partners

  • Co-immunoprecipitation experiments to verify interactions in cellular contexts

  • Structural studies to determine the molecular basis of these interactions

Functional Characterization

Recombinant SCAMP5 enables researchers to study the functional properties of this protein through:

  • Reconstitution experiments in artificial membrane systems

  • Complementation studies in scamp mutant plants

  • Structure-function analyses through mutation of specific protein domains

Antibody Production and Immunological Studies

Purified recombinant SCAMP5 can be used to generate specific antibodies for:

  • Detection and localization of endogenous SCAMP5 in plant tissues

  • Western blot analyses to quantify expression levels

  • Immunofluorescence microscopy to determine subcellular localization patterns

Stomatal Regulation

Research has implicated SCAMP proteins, including SCAMP5, in stomatal closure responses in Arabidopsis. Quantitative imaging studies have identified that mutants in genes encoding SCAMP membrane regulators are generally affected in stomatal closure, suggesting a role in plant responses to water stress and microbial challenges .

Drought Tolerance

As mentioned previously, plants with mutations in SCAMP genes display a drought-tolerant phenotype. This finding suggests that SCAMP5 may negatively regulate drought tolerance, potentially through its interaction with water channel proteins (PIPs) .

Elucidating the SCAMP-PIP Interplay

Current research efforts, such as those at the Van Damme laboratory, are focused on determining how SCAMP proteins contribute to the trafficking and/or regulation of PIPs. This research aims to clarify the functional relationship between these protein families and their impact on plant water relations .

Gene Expression Studies

SCAMP5 has been utilized as a reference gene in PCR reactions for gene expression studies, highlighting its relatively stable expression under various conditions. This property makes it valuable for normalizing gene expression data in Arabidopsis research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCAMP5; At1g11180; T28P6.15; Secretory carrier-associated membrane protein 5; Secretory carrier membrane protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SCAMP5
Target Protein Sequence
MGGRYDRNTFDEQDEVNPFANPGSVPAASNSRLSPLPPEPAGFGYGRTVDIPLDRPGSGA QDLKKKEKELQAKEADLRRREQDLKRKQDAAARAGIVIEAKNWPTFFPLIHHDIANEILV RLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYFISGVPGGYVLWYR PLYRAFRSDSAFNFGWFFLFYMLHILFCLFAAVAPPIVFKGKSLAGILPAIDVLSAQALV GIFYFIGFGLFCLESVVSIWVIQQVYMYFRGSGKADDMRRDAARGAMRAAI
Uniprot No.

Target Background

Function
Involved in membrane trafficking.
Database Links

KEGG: ath:AT1G11180

STRING: 3702.AT1G11180.2

UniGene: At.42147

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and localization of Arabidopsis thaliana SCAMP5?

SCAMP5 is part of a five-membered protein family in Arabidopsis that functions as tetraspanning integral membrane proteins. The protein structure consists of four transmembrane spans with cytoplasmic amino- and carboxy-termini, plus an E peptide domain that is essential for mediating SCAMP function . The protein is primarily localized to the trans-Golgi network and recycling endosomes, with dynamic trafficking to and from the plasma membrane . SCAMP5 exhibits particularly high mobility within cellular compartments, and short-term treatment with ES-9 (an endocytic inhibitor) causes accumulation of SCAMP5 at the plasma membrane, indicating the contribution of endocytosis to its dynamic localization .

How does SCAMP5 relate to other members of the SCAMP protein family?

In Arabidopsis thaliana, SCAMP5 belongs to a family of five SCAMP proteins that share structural similarities but demonstrate functional specialization. While all SCAMPs were initially characterized for their roles in endocytosis and membrane trafficking, recent research reveals broader functions including plasma membrane phase separation, cell plate formation, and responses to environmental stresses . SCAMP5 shares the characteristic four-transmembrane domain architecture with other family members but possesses unique N-terminal domains with specific protein interaction motifs, particularly the double NPF (asparagine-proline-phenylalanine) motif that facilitates interaction with endocytic machinery components .

What are the primary protein interaction partners of SCAMP5?

Research has identified several key interaction partners of SCAMP5 in Arabidopsis:

  • TPLATE complex (TPC) - SCAMP5 interacts with subunits of this endocytic complex

  • Plasma Membrane Intrinsic Proteins (PIPs) - These water channel proteins were identified as novel interactors of SCAMP5

  • AtEH1/Pan1 - The EH domains of this protein specifically interact with the N-terminal double NPF motif of SCAMP5

These interactions collectively suggest SCAMP5 plays an important role in coordinating membrane protein trafficking, particularly through the endocytic pathway. The interaction with PIPs specifically indicates a potential role in water transport regulation, which aligns with the observed drought-tolerant phenotype in scamp mutants .

How does SCAMP5 contribute to drought tolerance in Arabidopsis?

Recent research has revealed that scamp mutants exhibit a drought-tolerant phenotype, suggesting SCAMP5 plays a critical role in water homeostasis regulation . The mechanism appears to involve interactions between SCAMP5 and Plasma Membrane Intrinsic Proteins (PIPs), which function as aquaporins. Experimental evidence shows that scamp mutants display defects in the subcellular localization of mCherry-tagged PIP2;1, indicating that SCAMP5 regulates the trafficking and/or activity of these water channels .

The drought tolerance phenotype likely results from alterations in PIP trafficking that affect cellular water permeability. When SCAMP5 function is compromised, changes in PIP localization or abundance at the plasma membrane may reduce water loss during drought conditions. The current collaborative research between the Van Damme and Chaumont labs through an FWO-weave project specifically aims to determine how SCAMP proteins contribute to the trafficking and/or regulation of PIPs, which should provide more detailed mechanistic insights into this phenomenon .

What is the significance of the N-terminal double NPF motif in SCAMP5 function?

The N-terminal double NPF (asparagine-proline-phenylalanine) motif of SCAMP5 serves as a critical protein interaction domain that mediates endocytic trafficking. Comparative mass spectrometry identified this peptide as interacting specifically with the EH1.1 domain of AtEH1/Pan1, showing the highest fold change compared to EH1.2 and GFP controls . This interaction appears to be essential for the retrograde transport of SCAMP5 from the plasma membrane.

Experimental evidence for this function comes from studies comparing wild-type SCAMP5 with an N-terminally truncated version lacking the double NPF motif. The truncated ΔN-SCAMP5 showed:

  • Reduced endosomal localization

  • Increased plasma membrane accumulation

  • Altered trafficking dynamics

Quantitative analysis of plasma membrane versus cytoplasmic distribution confirmed statistically significant differences between wild-type and truncated versions, providing strong evidence that the double NPF motif functions as a retrograde transport signal in plants . This represents a novel trafficking signal that helps regulate SCAMP5 distribution between cellular compartments.

How do SCAMP5 functions in Arabidopsis compare to its roles in mammalian systems?

SCAMP5 functions show both conservation and divergence between plant and mammalian systems:

AspectArabidopsis SCAMP5Mammalian SCAMP5
LocalizationTrans-Golgi network, recycling endosomes, plasma membraneBrain-enriched, synaptic vesicles
Membrane traffickingEndocytosis, cell plate formationEndocytosis, synaptic vesicle recycling
Protein interactionsTPC, PIPs, AtEH1/Pan1Endocytic machinery proteins
Disease relevanceDrought stress responseHuntington's disease, Parkinson's disease, intellectual disability
Regulatory targetsPIP water channelsT-type calcium channels

In mammalian systems, SCAMP5 has been implicated in neurological functions and disorders. It regulates the accumulation of expanded polyglutamine proteins in Huntington's disease and controls the expression of T-type calcium channels in the plasma membrane . The expression of SCAMP5 is markedly increased in the striatum of Huntington's disease patients and is induced in cultured striatal neurons by endoplasmic reticulum stress .

While both plant and mammalian SCAMP5 are involved in membrane trafficking and endocytosis, they have evolved specialized functions appropriate to their biological contexts - neuronal function in mammals versus water homeostasis and stress responses in plants.

What are the recommended approaches for studying SCAMP5 localization and trafficking?

To effectively study SCAMP5 localization and trafficking in Arabidopsis, researchers should implement a multi-faceted approach:

  • Fluorescent protein tagging:

    • Generate C-terminal GFP fusion constructs (SCAMP5-GFP) for live-cell imaging

    • Compare with N-terminal truncation variants (e.g., ΔN-SCAMP5-GFP) to assess the role of specific domains

  • Colocalization studies:

    • Use dual-color imaging with markers for different cellular compartments

    • Example: SCAMP5-GFP and AtEH1/Pan1-mRuby3 colocalization revealed temporal dynamics during cell plate formation and cytokinesis

  • Pharmacological treatments:

    • Apply endocytic inhibitors (e.g., ES-9) to assess trafficking dynamics

    • Monitor plasma membrane accumulation following treatment

  • Quantitative analysis:

    • Measure plasma membrane vs. cytoplasmic signal intensity ratios

    • Use statistical analysis to compare different constructs or treatments

    • Example approach: Box-plot representation of PM/cytoplasm ratios from multiple independent lines

  • Time-lapse imaging:

    • Track SCAMP5 dynamics during developmental processes or stress responses

    • Particularly valuable during cell division and cytokinesis, where SCAMP5 recruitment to the cell plate precedes AtEH1/Pan1

The combination of these approaches provides comprehensive insights into both static localization and dynamic trafficking behaviors of SCAMP5 under various conditions.

How can researchers effectively generate and characterize scamp mutants in Arabidopsis?

Creating and characterizing scamp mutants requires systematic methodology:

  • Mutant generation approaches:

    • T-DNA insertion lines from stock centers (SALK, SAIL, GABI)

    • CRISPR-Cas9 genome editing for targeted mutations

    • RNAi or artificial microRNA for knockdown approaches

  • Genotyping protocols:

    • PCR-based genotyping with gene-specific and T-DNA border primers

    • Sequencing confirmation for CRISPR-edited lines

    • qRT-PCR to verify reduced transcript levels in knockdown lines

  • Phenotypic characterization:

    • Drought stress assays: Monitor water loss rates, survival under water limitation, and recovery after rewatering

    • Subcellular marker analysis: Examine PIP2;1-mCherry localization in wild-type versus mutant backgrounds

    • Root growth assays under various stress conditions

  • Complementation testing:

    • Transform mutants with wild-type SCAMP5 to confirm phenotype rescue

    • Utilize domain-specific variants (e.g., ΔN-SCAMP5) to assess functional requirements of specific protein regions

  • Higher-order mutant analysis:

    • Generate double or triple mutants with other SCAMP family members to assess functional redundancy

    • Create crosses with pip mutants to investigate genetic interactions

This comprehensive approach ensures robust characterization of mutant phenotypes and provides insights into the functional significance of SCAMP5 in Arabidopsis development and stress responses.

What methods are effective for studying SCAMP5-PIP interactions?

Investigating the interactions between SCAMP5 and Plasma Membrane Intrinsic Proteins (PIPs) requires specialized methodologies:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation (Co-IP) from plant tissues expressing tagged versions of SCAMP5 and PIPs

    • Yeast two-hybrid (Y2H) screening to identify specific interaction domains

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in planta

    • Proximity labeling approaches that have previously identified SCAMP5 in close proximity to TPC

  • Functional transport assays:

    • Water permeability measurements in protoplasts from wild-type versus scamp mutants

    • Heterologous expression systems (e.g., Xenopus oocytes) to assess PIP function when co-expressed with SCAMP5

    • Liposome-based transport assays with purified components

  • Trafficking studies:

    • Photoconvertible fluorescent protein fusions to track PIP trafficking in the presence/absence of SCAMP5

    • Endocytosis inhibitor treatments to assess changes in PIP internalization rates

    • Quantitative colocalization analysis of SCAMP5 and PIPs across different cellular compartments

  • Stress response experiments:

    • Compare wild-type and scamp mutant responses to drought stress, focusing on PIP localization

    • Analyze PIP phosphorylation status, which often regulates aquaporin activity, in the presence/absence of SCAMP5

    • Monitor root hydraulic conductivity as a measure of functional PIP activity in intact plants

These methodologies provide complementary approaches to elucidate both the physical interaction and functional relationship between SCAMP5 and PIPs, supporting the ongoing collaborative research described in the search results .

How should researchers interpret contradictory findings in SCAMP5 studies?

When encountering contradictory findings in SCAMP5 research, implement the following analytical framework:

This systematic approach helps researchers navigate seemingly contradictory findings and extract meaningful biological insights from complex datasets.

What statistical approaches are appropriate for analyzing SCAMP5 trafficking dynamics?

Quantitative analysis of SCAMP5 trafficking requires rigorous statistical methodology:

  • Compartment distribution analysis:

    • Measure fluorescence intensity ratios between plasma membrane and cytoplasm

    • Apply appropriate statistical tests: use Tukey multiple pairwise-comparisons for comparing multiple constructs or conditions

    • Present data using box plots showing distribution, median, and outliers with sample sizes clearly indicated

  • Time-series analysis for dynamic trafficking:

    • Implement kymograph analysis to visualize protein movement over time

    • Apply regression models to characterize trafficking rates

    • Consider hidden Markov models for identifying discrete trafficking states

  • Colocalization quantification:

    • Calculate Pearson's correlation coefficient or Manders' overlap coefficient between SCAMP5 and compartment markers

    • Use object-based colocalization analysis for vesicular structures

    • Implement spatial statistics to assess clustering patterns

  • Comparative experimental design:

    • Use paired experimental designs when possible

    • Implement mixed-effects models for experiments with multiple variables

    • Ensure sufficient biological and technical replicates (minimum n=3 biological replicates with multiple cells per replicate)

  • Data visualization standards:

    • Use heat maps or color-coded intensity images to represent concentration gradients

    • Present raw images alongside quantification

    • Include appropriate scale bars and time indicators for dynamic studies

In the published research, statistical significance between wild-type SCAMP5-GFP and ΔN-SCAMP5-GFP plasma membrane localization was established using Tukey multiple pairwise-comparisons with P < 0.001, demonstrating the importance of rigorous statistical analysis in trafficking studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.