Recombinant Arabidopsis thaliana Serine/threonine-protein phosphatase 5 (PAPP5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PAPP5; PP5; At2g42810; F7D19.19; Serine/threonine-protein phosphatase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAPP5
Target Protein Sequence
METKNENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKL EEYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRK LKECEKAVMKLKFEEAISVPVSERRSVAESIDFHTIGNKPRSSSMPTKTALAAVVAAVMV VAVRGFATTEILMVLVSVVLGTFWWGSFSGKVEPQYSGARIEGEEVTLDFVKTMMEDFKN QKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNGLP SEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGEVR SKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEEGL MCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDG KLITVFSAPNYCDQMGNKGAFIRFEAPDMKPNIVTFSAVPHPDVKPMAYANNFLRMFN
Uniprot No.

Target Background

Function

Isoform 2 dephosphorylates phosphorylated phytochromes, exhibiting a preference for Pfr forms. This enhances phytochrome-mediated photoresponses, likely by increasing their stability and binding affinity for light signal transducers such as NDPK2. Para-nitrophenylphosphate (pNPP) can be used as a substrate.

Gene References Into Functions
  1. Research suggests that PAPP5 responds to imbalances in tetrapyrrole biosynthesis through Mg-ProtoIX accumulation, acting as a negative regulator of PhANG expression during chloroplast biogenesis and development. PMID: 23555952
  2. Arabidopsis thaliana PP5 exhibits multiple enzymatic activities modulated by conformational changes induced by heat-shock stress. PMID: 21564098
Database Links

KEGG: ath:AT2G42810

STRING: 3702.AT2G42810.2

UniGene: At.23737

Protein Families
PPP phosphatase family, PP-5 (PP-T) subfamily
Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.; [Isoform 2]: Cytoplasm. Nucleus, nucleoplasm. Nucleus speckle. Note=Cytoplasmic in darkness, but translocated to the nucleus upon illumination, when associated with phytochromes into speckles.

Q&A

What is PAPP5 and what are its primary functions in Arabidopsis thaliana?

PAPP5 (Phytochrome-Associated Protein Phosphatase 5) is a serine/threonine protein phosphatase that plays crucial roles in multiple signaling pathways in Arabidopsis thaliana. Its primary functions include:

  • Dephosphorylation of active Pfr phytochromes, thus enhancing phytochrome-mediated responses

  • Involvement in tetrapyrrole-mediated plastid signaling

  • Regulation of photosynthesis-associated nuclear genes (PhANGs) during chloroplast biogenesis and development

  • Interaction with MAX2 to modulate KAR/KL (karrikin/KAI2 ligand) dependent responses

PAPP5 acts as a negative regulator of PhANG expression during chloroplast development by receiving signals related to imbalances in tetrapyrrole biosynthesis, particularly through the accumulation of magnesium protoporphyrin IX (Mg-ProtoIX) . Its phosphatase activity is essential for mediating retrograde signaling from plastids to the nucleus.

How does PAPP5 differ structurally and functionally from other protein phosphatases in plants?

PAPP5 belongs to the PP5 family of serine/threonine phosphatases but possesses distinct structural features that influence its function:

  • The structure of PAPP5 has been determined at 3 Å resolution through crystallography, revealing important structural domains

  • Similar to mammalian PP5 homologs, PAPP5 has an auto-inhibitory mechanism that can be relieved by specific activators

  • PAPP5 can be activated by arachidonic acid, suggesting a regulatory pathway connecting plant defense mechanisms and phytochrome regulation

  • Unlike many other phosphatases, PAPP5 shows specific interaction with tetrapyrrole intermediates like Mg-ProtoIX, making it crucial for chloroplast retrograde signaling

The activation mode of PAPP5 appears to be similar to that of its mammalian counterparts, though the physiological relevance of this in plants requires further investigation .

What phenotypes are observed in papp5 mutants and what do they reveal about PAPP5 function?

Studies of papp5 mutants have revealed several important phenotypes that provide insights into PAPP5 function:

  • When introduced into the crd (chloroplast biogenesis) mutant background, papp5 mutation reverts the pale phenotype of crd

  • The papp5crd double mutant accumulates wild-type levels of chlorophyll, develops proper chloroplasts, and shows normal induction of PhANG expression in response to light, unlike the crd single mutant

  • papp5 mutants show altered responses to tetrapyrrole accumulation, indicating PAPP5 is required for proper response to these metabolites

  • In the context of MAX2 signaling, papp5 mutants show affected KAR/KL-dependent seed germination under suboptimal conditions and altered seedling development

These phenotypes collectively demonstrate that PAPP5 functions as a negative regulator in tetrapyrrole-mediated plastid signaling and plays specific roles in light and karrikin response pathways.

What are the optimal methods for expressing and purifying recombinant PAPP5 protein?

For optimal expression and purification of recombinant PAPP5, researchers should consider the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) strains are commonly used for PAPP5 expression, though eukaryotic systems like insect cells may be considered for studies requiring post-translational modifications

  • Vector design: Include a suitable affinity tag (His-tag or GST-tag) for purification, with an optional protease cleavage site if the tag might interfere with activity assays

  • Induction conditions: IPTG concentration of 0.5-1.0 mM at 18-22°C for 16-20 hours typically yields the best balance of expression and solubility

  • Lysis buffer optimization: Use buffers containing 50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 10% glycerol, and 5 mM β-mercaptoethanol with protease inhibitors

  • Purification strategy:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography to obtain homogeneous protein

Maintaining protein activity requires careful buffer selection during purification, as PAPP5 phosphatase activity can be sensitive to metal ions and oxidizing conditions . For crystallization purposes, protein purity >95% is typically required, as achieved in the structural determination at 3 Å resolution .

What assays are available to measure PAPP5 phosphatase activity and how reliable are they?

Several assays can be employed to measure PAPP5 phosphatase activity, each with specific advantages and limitations:

  • Synthetic phosphopeptide substrates:

    • Using defined phosphopeptides that mimic natural substrates

    • Detection via colorimetric (pNPP) or fluorometric (MUP) readouts

    • Advantages: Quantitative, straightforward implementation

    • Limitations: May not fully represent in vivo activity

  • Phosphoprotein substrates:

    • Using recombinant phosphorylated proteins (e.g., phosphorylated phytochrome)

    • Detection via western blot with phospho-specific antibodies

    • Advantages: More physiologically relevant

    • Limitations: Technically more challenging

  • In vivo phosphorylation assays:

    • Complementation of papp5 mutants with wild-type or mutant PAPP5

    • Analysis of phosphorylation states of natural substrates

    • Advantages: Most physiologically relevant

    • Limitations: Complex system with multiple variables

The reliability of these assays can be significantly affected by:

  • Purity of the recombinant PAPP5 protein

  • Presence of activators/inhibitors (e.g., arachidonic acid acts as an activator)

  • Buffer composition, especially metal ion concentrations

  • Temperature and pH conditions

For validation, inhibitor studies using phosphatase inhibitors can be performed, as demonstrated in studies where inhibition of phosphatase activity in the crd mutant phenocopied the papp5crd phenotype .

How can researchers effectively investigate PAPP5-protein interactions in vitro and in vivo?

Investigating PAPP5 protein interactions requires complementary approaches:

In vitro methods:

  • Pull-down assays:

    • Using recombinant PAPP5 with GST or His tags

    • Prey proteins can be cellular extracts or purified proteins

    • Detection via western blotting or mass spectrometry

    • Example: Demonstrated successful detection of PAPP5-MAX2 interactions

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Provides real-time binding kinetics (kon, koff, KD)

    • Requires highly purified proteins

    • Excellent for determining binding affinities

  • Isothermal Titration Calorimetry (ITC):

    • Label-free detection of binding thermodynamics

    • Determines stoichiometry and binding affinity

    • Suitable for studying PAPP5 interactions with small molecules like tetrapyrroles

In vivo methods:

  • Co-immunoprecipitation:

    • Example method: Anti-cMYC monoclonal antibody bound to protein G coated magnetic beads used for immunoprecipitation

    • Followed by western blotting to detect interacting partners

    • Particularly suitable for detecting PAPP5 interactions in plant tissues

  • Bimolecular Fluorescence Complementation (BiFC):

    • Visualization of protein interactions in living cells

    • Requires fusion of split fluorescent protein fragments to PAPP5 and potential partners

    • Allows subcellular localization of interactions

  • Tandem affinity purification:

    • Using tagged PAPP5 expressed in Arabidopsis cell cultures

    • Successful approach for identifying PAPP5 as an interactor of MAX2

    • Combined with mass spectrometry for unbiased identification of interaction partners

For specific tetrapyrrole binding studies, researchers have successfully used immunoprecipitated PAPP5 complexes incubated with Mg-ProtoIX (2.5 mM) followed by spectrofluorometric quantification with excitation at 416 nm .

What is the precise role of PAPP5 in tetrapyrrole-mediated plastid signaling?

PAPP5 functions as a critical component in tetrapyrrole-mediated plastid-to-nucleus retrograde signaling through these specific mechanisms:

  • Sensing tetrapyrrole accumulation: PAPP5 can detect imbalances in tetrapyrrole biosynthesis, particularly through the accumulation of Mg-ProtoIX and Mg-ProtoIX-ME intermediates

  • Signal transduction: Once activated by tetrapyrrole binding, PAPP5's phosphatase activity mediates the retrograde signal from chloroplasts to the nucleus

  • Transcriptional regulation: PAPP5 acts as a negative regulator of photosynthesis-associated nuclear genes (PhANGs) during chloroplast biogenesis and development

  • Genetic interaction with chloroplast biogenesis pathways: The papp5 mutation reverses the phenotypic defects in the crd mutant, which accumulates Mg-ProtoIX and Mg-ProtoIX-ME

Evidence from genetic and biochemical studies shows that PAPP5 functions downstream of tetrapyrrole accumulation in the signaling pathway. Inhibition of PAPP5 phosphatase activity in the crd mutant phenocopies the papp5crd double mutant, demonstrating that the phosphatase activity of PAPP5 is essential for mediating the retrograde signal .

The current model suggests that when tetrapyrrole intermediates accumulate, they interact with PAPP5, modulating its phosphatase activity, which subsequently affects the phosphorylation state of key transcription factors or other signaling components that regulate PhANG expression.

How does PAPP5 interact with tetrapyrroles at the molecular level?

The molecular interaction between PAPP5 and tetrapyrroles, particularly Mg-ProtoIX, involves several specific structural and functional aspects:

  • Binding specificity: PAPP5 shows preferential binding to Mg-ProtoIX and Mg-ProtoIX-ME over other tetrapyrrole intermediates, suggesting a specific recognition mechanism

  • Binding domain: While the exact binding domain hasn't been fully characterized, structural studies suggest that tetrapyrrole binding may influence the conformation of PAPP5, potentially relieving its auto-inhibitory mechanism similar to how arachidonic acid activates the enzyme

  • Allosteric regulation: Binding of Mg-ProtoIX likely causes allosteric changes in PAPP5 structure that modulate its phosphatase activity, though the precise conformational changes remain to be determined

  • Binding parameters: Experimental approaches using immunoprecipitated PAPP5 complexes incubated with 2.5 mM Mg-ProtoIX at 4°C for 1 hour have demonstrated successful binding that can be quantified by spectrofluorometry with excitation at 416 nm

The molecular details of this interaction warrant further investigation through techniques such as:

  • X-ray crystallography of PAPP5-tetrapyrrole complexes

  • Site-directed mutagenesis to identify critical residues involved in tetrapyrrole binding

  • Hydrogen/deuterium exchange mass spectrometry to map conformational changes upon binding

Understanding these molecular interactions is essential for elucidating how tetrapyrroles modulate PAPP5 activity in retrograde signaling.

What approaches can be used to study the in vivo relevance of PAPP5-tetrapyrrole interactions?

To investigate the in vivo relevance of PAPP5-tetrapyrrole interactions, researchers can employ several complementary approaches:

  • Tetrapyrrole feeding experiments:

    • Exogenous application of tetrapyrroles to wild-type and papp5 mutant plants

    • Monitoring changes in PhANG expression, chloroplast development, and other phenotypes

    • This approach has successfully demonstrated that PAPP5 is required for proper response to tetrapyrrole accumulation

  • Genetic manipulation of tetrapyrrole biosynthesis:

    • Creating double mutants between papp5 and mutants affecting tetrapyrrole biosynthesis (as demonstrated with papp5crd)

    • Analysis of epistatic relationships and phenotypic rescue

    • Measurement of tetrapyrrole intermediate levels in different genetic backgrounds

  • In situ detection of PAPP5-tetrapyrrole interactions:

    • Fluorescence resonance energy transfer (FRET) between tagged PAPP5 and natural fluorescence of tetrapyrroles

    • Subcellular localization studies to determine where these interactions occur

    • Correlation of interaction dynamics with physiological responses

  • Structure-function studies using PAPP5 variants:

    • Generation of PAPP5 mutants with altered tetrapyrrole binding capacities

    • Complementation of papp5 mutants with these variants

    • Correlation of binding capacity with physiological function

  • Temporal regulation analysis:

    • Time-course studies following light exposure or other environmental changes

    • Correlation of PAPP5-tetrapyrrole interaction dynamics with changes in gene expression

    • Integration with other signaling pathways

These approaches collectively can provide a comprehensive understanding of how PAPP5-tetrapyrrole interactions contribute to plastid signaling under physiologically relevant conditions.

How does PAPP5 regulate phytochrome signaling through protein dephosphorylation?

PAPP5 specifically regulates phytochrome signaling through dephosphorylation mechanisms that affect phytochrome activity:

  • Substrate specificity: PAPP5 preferentially dephosphorylates the active Pfr form of phytochromes

  • Functional consequences: Dephosphorylation by PAPP5 enhances phytochrome-mediated responses rather than attenuating them

  • Mechanistic pathway: The dephosphorylation appears to modify phytochrome stability, subcellular localization, or interaction with downstream signaling components

  • Regulation mechanism: PAPP5's phosphatase activity is itself regulated, potentially by:

    • Arachidonic acid, which activates PAPP5

    • Conformational changes upon binding to phytochromes

    • Other signaling molecules that modulate its enzymatic activity

The specific phosphorylation sites targeted by PAPP5 on phytochromes remain under investigation, but structural studies have examined the interaction details and dynamics of PAPP5 with phospho-site mimicking mutant PHYB molecules . This research has provided insight into the positional arrangement of PAPP5's domains during interaction with its substrate.

Understanding this regulatory mechanism is crucial as it represents a point of integration between light perception (via phytochromes) and other signaling pathways that may modulate PAPP5 activity.

What experimental systems best demonstrate the impact of PAPP5 on light-regulated development?

Several experimental systems effectively demonstrate PAPP5's impact on light-regulated development:

  • De-etiolation assays:

    • Monitoring hypocotyl elongation in dark-grown seedlings transferred to different light conditions

    • Comparing wild-type, papp5 mutant, and complemented lines

    • Quantifying response differences under various light qualities (red, far-red, blue)

  • PhANG expression analysis:

    • Real-time qPCR measurement of light-regulated nuclear gene expression

    • RNA-seq analysis of global transcriptional changes

    • Comparison between wild-type and papp5 mutant responses to light

    • The papp5crd double mutant showed normal induction of PhANG expression in response to light, unlike the crd single mutant

  • Chloroplast development analysis:

    • Microscopic examination of chloroplast structure

    • Chlorophyll fluorescence measurements

    • Analysis of photosynthetic efficiency

    • The papp5crd double mutant developed proper chloroplasts, unlike the crd single mutant with poorly developed chloroplasts

  • Shade avoidance responses:

    • Measurement of architectural changes in response to shade signals

    • Comparison of response magnitude and kinetics between genotypes

    • Integration with other shade-responsive mutants

  • Photomorphogenic marker gene analysis:

    • Using reporter gene constructs (GUS, LUC, GFP) driven by light-responsive promoters

    • Quantitative analysis of expression patterns in different genetic backgrounds

    • Spatial and temporal resolution of PAPP5 effects

These systems collectively provide a comprehensive view of how PAPP5 influences light-regulated developmental processes at multiple levels, from gene expression to organismal responses.

How might the activation of PAPP5 by arachidonic acid link plant defense mechanisms and phytochrome regulation?

The activation of PAPP5 by arachidonic acid suggests a novel regulatory pathway connecting plant defense responses and phytochrome signaling:

  • Structural basis: The sterical consequences of PAPP5 activation by arachidonic acid have been examined through crystallization studies, revealing a mechanism similar to mammalian PP5 activation

  • Potential signaling integration: This activation mechanism may serve as a point of crosstalk between:

    • Stress responses that trigger fatty acid signaling

    • Light signaling pathways regulated by phytochromes

    • Plastid retrograde signaling involving tetrapyrroles

  • Physiological relevance: During pathogen attack or wounding:

    • Arachidonic acid or related fatty acids may be released

    • PAPP5 activation could modulate phytochrome signaling

    • This could coordinate growth and defense responses appropriately

  • Experimental approaches to investigate this connection:

    • Application of arachidonic acid to plants and measurement of phytochrome-regulated responses

    • Analysis of papp5 mutant responses to pathogen infection or mechanical wounding

    • Investigation of how light conditions affect defense responses in wild-type versus papp5 plants

    • Creation of PAPP5 variants with altered arachidonic acid sensitivity

  • Evolutionary perspective: The similarity in activation modes between plant PAPP5 and mammalian counterparts suggests a deeply conserved regulatory mechanism , potentially with divergent functional outcomes in different kingdoms

While this connection presents an intriguing hypothesis, further research is needed to validate this model in planta and elucidate the molecular details of how PAPP5 integrates these diverse signaling inputs.

How does PAPP5 interact with MAX2 and influence karrikin/strigolactone signaling pathways?

Recent research has identified PAPP5 as a novel interactor of MORE AXILLARY GROWTH 2 (MAX2), suggesting complex roles in karrikin (KAR) and strigolactone (SL) signaling:

  • Interaction specificity: Quantitative affinity purification demonstrated that PAPP5 is more present in KAI2 (KARRIKIN INSENSITIVE 2) protein complexes rather than in D14 (DWARF14) complexes

  • Functional relevance:

    • PAPP5 primarily modulates KAR/KL (KAI2 ligand)-dependent seed germination under suboptimal conditions

    • It influences seedling development through the KAR/KL pathway

    • It appears to have less pronounced effects on SL-specific responses

  • Molecular mechanism: PAPP5 likely acts through dephosphorylation of MAX2 in vivo

    • Phosphopeptide enrichment experiments suggest this action occurs independently of synthetic SL analog treatment (rac-GR24)

    • This dephosphorylation may regulate MAX2 activity, stability, or interactions with other proteins

  • Integrated model: PAPP5 represents another connection between light signaling and karrikin/strigolactone pathways

    • As a phosphatase that regulates both phytochromes and MAX2

    • Potentially integrating environmental and developmental signals

This newly discovered role of PAPP5 adds another layer of complexity to our understanding of how this phosphatase functions at the nexus of multiple signaling pathways in plants.

What technical challenges exist in crystallizing PAPP5 and how might they be overcome?

Crystallizing PAPP5 presents several technical challenges that researchers need to address:

  • Protein conformational heterogeneity:

    • PAPP5 may exist in multiple conformational states due to its regulatory mechanisms

    • Solution: Stabilize specific conformations using inhibitors, activators, or substrate analogs

    • The successful crystallization at 3 Å resolution was achieved by addressing these conformational issues

  • Post-translational modifications:

    • Native PAPP5 may have phosphorylation or other modifications

    • Solution: Use homogeneous recombinant protein or site-directed mutagenesis to create modification-mimicking variants

  • Protein stability and solubility:

    • Maintaining active, properly folded protein throughout purification and crystallization

    • Solution: Optimize buffer conditions, consider fusion partners, and test various additives that promote stability

  • Crystallization conditions optimization:

    • Finding the precise conditions for crystal nucleation and growth

    • Solution: High-throughput screening of crystallization conditions, including:

      • pH variations (typically 6.5-8.0 range)

      • Different precipitants (PEG varieties, ammonium sulfate)

      • Various additives (especially those that might stabilize specific conformations)

      • Temperature variations

  • Crystal quality improvement:

    • Initial crystals may diffract poorly

    • Solution: Crystal seeding, optimization of cryoprotection, and post-crystallization treatments

  • Co-crystallization challenges:

    • Obtaining structures of PAPP5 with binding partners or substrates

    • Solution: Stabilize complexes through crosslinking or use of non-hydrolyzable substrate analogs

The successful determination of PAPP5 structure at 3 Å resolution demonstrates that these challenges can be overcome with appropriate experimental approaches.

How can we reconcile potentially contradictory data about PAPP5 function across different experimental systems?

Reconciling contradictory data about PAPP5 function requires careful consideration of several factors:

  • Context-dependent functions:

    • PAPP5 participates in multiple signaling pathways (phytochrome, tetrapyrrole, MAX2)

    • Its function may differ depending on developmental stage, tissue type, or environmental conditions

    • Solution: Clearly define the experimental context when comparing results

  • Genetic background effects:

    • The phenotypic impact of papp5 mutations may depend on other genes

    • This is exemplified by the difference between papp5 single mutants and papp5crd double mutants

    • Solution: Use isogenic backgrounds and multiple alleles when possible

  • Substrate specificity:

    • PAPP5 may dephosphorylate different substrates under different conditions

    • This could lead to apparently contradictory outcomes if different substrates are affected

    • Solution: Identify and characterize the full range of PAPP5 substrates in each context

  • Methodological differences:

    • Different assay systems may measure different aspects of PAPP5 function

    • In vitro versus in vivo approaches may yield different results

    • Solution: Use complementary approaches and standardize methodologies when possible

  • Data integration framework:

    • Create comprehensive models that incorporate all observations

    • Example reconciliation: PAPP5 enhances phytochrome responses through dephosphorylation while suppressing PhANG expression in response to tetrapyrrole accumulation - these can be reconciled by considering these as separate signaling pathways that converge on different targets

  • Temporal dynamics:

    • PAPP5 may have different roles at different time points after stimulus perception

    • Solution: Conduct detailed time-course studies to capture the dynamic nature of PAPP5 function

By considering these factors and designing experiments that directly address apparent contradictions, researchers can develop more nuanced models of PAPP5 function across different biological contexts.

How does natural variation in PAPP5 contribute to adaptive responses in different Arabidopsis accessions?

Natural variation in PAPP5 may contribute to adaptive responses in different Arabidopsis accessions, though this specific area remains less explored:

  • Potential sources of PAPP5 variation:

    • Coding sequence polymorphisms affecting protein function

    • Regulatory variations affecting expression levels

    • Splicing variations affecting protein isoform abundance

  • Adaptive significance:

    • Given PAPP5's roles in light signaling , tetrapyrrole-mediated plastid signaling , and karrikin responses , variations could contribute to:

      • Adaptation to different light environments

      • Tolerance to different temperature regimes

      • Altered developmental timing in response to seasonal cues

  • Approaches to study natural variation in PAPP5:

    • Genome-wide association studies (GWAS) focusing on traits related to PAPP5 function

    • The high density of SNPs in Arabidopsis (approximately 1 in every 200 bp between accessions) suggests potential variation in PAPP5

    • Recombinant inbred line (RIL) populations could be used to map QTLs related to PAPP5 function

    • MAGIC (multiple advanced generation intercross) or AMPRIL (Arabidopsis multiparent RIL) populations offer additional resolution for studying complex traits

  • Validation approaches:

    • Complementation of papp5 mutants with PAPP5 alleles from different accessions

    • Targeted sequencing of PAPP5 across diverse Arabidopsis accessions

    • Analysis of PAPP5 expression patterns in different accessions under varied conditions

This research direction could reveal how variation in a single regulatory component like PAPP5 contributes to adaptive plasticity across different environmental conditions.

What approaches can identify natural PAPP5 variants and assess their functional significance?

Several complementary approaches can be employed to identify natural PAPP5 variants and assess their functional significance:

  • Sequence-based identification:

    • Targeted resequencing of PAPP5 locus across diverse Arabidopsis accessions

    • Mining existing genomic datasets like the 1001 Genomes Project for PAPP5 variants

    • Analysis of both coding regions and regulatory elements

  • Expression variation analysis:

    • RNA-seq data comparison across accessions

    • eQTL mapping to identify genetic variants affecting PAPP5 expression

    • Analysis of splicing variations that might generate different PAPP5 isoforms

  • Functional validation approaches:

    • Complementation assays: Testing if PAPP5 variants from different accessions can rescue papp5 mutant phenotypes

    • In vitro enzyme activity assays with recombinant proteins from different variants

    • Yeast two-hybrid or co-immunoprecipitation assays to test if variants differ in protein interaction capabilities

  • Phenotypic analysis:

    • Detailed phenotyping of accessions with different PAPP5 variants

    • Focus on traits related to known PAPP5 functions:

      • Chloroplast development

      • PhANG expression patterns

      • Light and karrikin responses

      • Tetrapyrrole responsiveness

  • Population genetics approaches:

    • Tests for selection signatures at the PAPP5 locus

    • Geographic distribution analysis of specific PAPP5 variants

    • Correlation with environmental parameters

  • CRISPR-based allele replacement:

    • Precise editing of PAPP5 to convert between naturally occurring variants

    • Analysis of phenotypic consequences in isogenic backgrounds

These approaches leverage Arabidopsis' advantages as a model organism, including its selfing nature (allowing generation of inbred lines) and the extensive genetic resources available, such as the approximately 60 RIL populations available from stock centers .

How might PAPP5 functional studies benefit from advanced multi-parent recombinant inbred line populations?

Advanced multi-parent recombinant inbred line populations offer several distinct advantages for PAPP5 functional studies:

  • Increased genetic diversity:

    • MAGIC (multiple advanced generation intercross) and AMPRIL (Arabidopsis multiparent RIL) populations incorporate genetic diversity from multiple founder accessions

    • This increases the likelihood of capturing functional PAPP5 variants

  • Enhanced mapping resolution:

    • These populations generate more recombination events than traditional bi-parental RILs

    • This allows finer mapping of QTLs affecting PAPP5-dependent traits

    • The MAGIC design particularly generates more recombination events per line than the AMPRIL strategy

  • Complex trait dissection:

    • PAPP5 functions at the intersection of multiple signaling pathways

    • Multi-parent populations are ideally suited for dissecting complex traits with multiple genetic influences

    • They allow detection of epistatic interactions between PAPP5 and other components of signaling networks

  • Repeatability of phenotyping:

    • These immortalized populations can be repeatedly phenotyped for different PAPP5-related traits

    • This allows investigation of:

      • Different environmental conditions

      • Different developmental stages

      • Multiple aspects of PAPP5 function

  • Integration with systems biology approaches:

    • Multi-omics profiling of these populations

    • Network modeling of PAPP5 interactions

    • Identification of new PAPP5 functions through correlated traits

  • Practical experimental design benefits:

    • Trait values with low heritability can be estimated more precisely due to replication

    • Correlation analysis between different traits can reveal fitness trade-offs

    • Response norms to different environments can be assessed systematically

While mapping in these multi-parent populations is more complex than with traditional RILs, modern computational approaches and high-density marker data make it feasible to extract meaningful insights about PAPP5 function and regulation from these powerful genetic resources .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.