Recombinant Arabidopsis thaliana Sphingoid base hydroxylase 1 (SBH1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Sphingoid Base Hydroxylase 1 (SBH1)

Recombinant Arabidopsis thaliana Sphingoid Base Hydroxylase 1 (SBH1) is an enzyme encoded by the gene AT1G69640 in Arabidopsis thaliana. This enzyme is involved in sphingoid biosynthesis, a crucial pathway for producing sphingolipids, which are essential components of plant cell membranes. SBH1 functions as a sphingosine hydroxylase, catalyzing the hydroxylation of sphingoid bases, and is located in the endoplasmic reticulum and Golgi apparatus .

Function and Role of SBH1

SBH1 plays a significant role in the sphingoid biosynthetic process, contributing to the modification of sphingoid bases. These modifications are important for the synthesis of complex sphingolipids, which are involved in various cellular processes, including cell signaling and membrane structure maintenance. Additionally, SBH1 is implicated in photomorphogenesis, a process that regulates plant development in response to light .

Gene Ontology and Cellular Localization

SBH1 is categorized under the biological process of fatty acid biosynthesis and oxidation-reduction processes. It exhibits molecular functions such as iron ion binding and oxidoreductase activity. The enzyme is localized in the endoplasmic reticulum and Golgi apparatus, where it can effectively participate in sphingoid base modification .

Research Findings and Implications

Research on SBH1 has primarily focused on its role in sphingoid biosynthesis and its potential impact on plant development. While its effect on senescence is unclear, studies suggest that sphingolipid metabolism can influence various physiological processes in plants, including stress responses and cell signaling pathways .

Data Tables

Table 1: Key Features of SBH1

FeatureDescription
Gene IDAT1G69640
OrganismArabidopsis thaliana
FunctionSphingosine hydroxylase activity
LocationEndoplasmic reticulum, Golgi apparatus
Biological ProcessSphingoid biosynthesis, photomorphogenesis

Table 2: Gene Ontology Categories for SBH1

CategoryDescription
Biological ProcessFatty acid biosynthesis, oxidation-reduction process
Molecular FunctionIron ion binding, oxidoreductase activity
Cellular ComponentEndoplasmic reticulum, Golgi apparatus

References

  1. Leaf Senescence DataBase - National Genomics Data Center: Provides detailed information on the SBH1 gene, including its function and localization in Arabidopsis thaliana.

  2. Cochrane Handbook: Offers guidance on presenting research findings in a structured format, which could be applied to studies involving SBH1.

  3. PMC - Sphingosine Kinase in Arabidopsis: Discusses the role of sphingolipids in plant cell signaling, which is relevant to understanding the broader context of sphingoid base metabolism.

  4. BioGRID - SBH1 Interactions: Lists interactors and interactions for the SBH1 protein, providing insights into its potential regulatory networks.

  5. OHDSI Forums - Standard Table 1: Discusses the importance of standardized data presentation in research studies, applicable to organizing data related to SBH1 research.

  6. Frontiers in Plant Science - AtPAP1 and Phenolic Acid Biosynthesis: While not directly related to SBH1, this article highlights the use of transcriptomic analysis in plant research, a method that could be applied to studying SBH1's role in Arabidopsis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
SBH1; At1g69640; F24J1.22; T6C23.16; Sphinganine C4-monooxygenase 1; Sphingoid C4-hydroxylase 1; Sphingoid base hydroxylase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SBH1
Target Protein Sequence
MMMGFAVSDELLGTVAPIVVYWLYSGIYVALSSLESYRLHSKVEEEEKNLVSKSSVVKGV LVQQVVQAVVAILLFTVTGSDAEADKAQQFSFLVLARQFVTAMIVLDTWQYFMHRYMHQN KFLYKHIHSQHHRLIVPYAYGALYNHPVEGLLLDTIGGALSFLVSGMSPRTSIFFFSFAT IKTVDDHCGLWLPGNLFHMVFKNNSAYHDIHHQLYGTKYNFSQPFFVMWDRILGTYMPYS LEKREDGGFEARPTKEFKDD
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana Sphingoid base hydroxylase 1 (SBH1) is involved in the biosynthesis of sphingolipid trihydroxy long-chain bases (4-hydroxysphinganine). It utilizes C18- and C20-sphinganine substrates to produce C18- and C20-phytosphinganines (D-ribo-2-amino-1,3,4-trihydroxyoctadecane and -eicosane).
Gene References Into Functions
  1. Growth reductions observed in SBH1 and SBH2 double mutants and RNA interference studies were dependent on trihydroxy LCB content in sphingolipids. [SBH1] PMID: 18612100
Database Links

KEGG: ath:AT1G69640

STRING: 3702.AT1G69640.1

UniGene: At.27818

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous, with higher levels in flowers and roots.

Q&A

What is Sphingoid base hydroxylase 1 (SBH1) and what role does it play in Arabidopsis thaliana?

SBH1 is an enzyme in Arabidopsis thaliana that functions as a sphingoid base hydroxylase, playing a crucial role in sphingolipid metabolism. Specifically, it catalyzes the hydroxylation of sphingoid bases, which is essential for proper membrane structure and function in plants. The protein is available as a recombinant product for research purposes . SBH1 contributes to numerous physiological processes including stress responses, cellular differentiation, and developmental regulation, making it an important subject for plant biology research.

Why is Arabidopsis thaliana used as a model organism for studying proteins like SBH1?

Arabidopsis thaliana serves as an excellent model organism for studying SBH1 and other proteins due to several key advantages:

  • Short life cycle (approximately 6 weeks from germination to mature seed)

  • Compact genome that has been fully sequenced

  • Extensive genetic and molecular tools available

  • Easy cultivation in laboratory settings

  • Self-fertilization capability

How do mutations in SBH1 affect plant development and viability?

While the search results don't provide specific information about SBH1 mutations, we can draw parallels from other essential Arabidopsis genes. Mutations in critical genes like HOG1 (which encodes S-adenosyl-L-homocysteine hydrolase) can result in several developmental defects:

For instance, point mutations in HOG1 result in genome-wide demethylation and poor growth, while insertion mutations cause zygotic lethality . Similar patterns might be expected for SBH1 if it plays an essential role in sphingolipid metabolism, which is critical for plant development.

What expression systems are most effective for producing recombinant Arabidopsis thaliana SBH1?

For successful expression of recombinant Arabidopsis thaliana SBH1, researchers should consider the following systems based on experimental needs:

Expression SystemAdvantagesLimitationsBest Used For
E. coli (BL21)Rapid growth, high yield, cost-effectiveLimited post-translational modificationsInitial structural studies, antibody production
Yeast (P. pastoris)Eukaryotic post-translational processingLonger growth time than bacteriaFunctional studies requiring proper protein folding
Insect cells (Sf9)Complex eukaryotic modificationsMore expensive, technically demandingHigh-quality protein for enzymatic assays
Plant expression (N. benthamiana)Native-like modificationsLower yieldIn planta interaction studies

When expressing membrane-associated proteins like SBH1, adding solubility tags (such as MBP or SUMO) and optimizing induction conditions (lower temperature, 16-20°C) can significantly improve protein yield and solubility .

What purification strategies work best for recombinant SBH1 protein?

Purifying recombinant SBH1 requires special considerations due to its membrane-associated nature:

  • Lysis buffer optimization:

    • Include 1-2% mild detergents (DDM, CHAPS, or Triton X-100)

    • Add glycerol (10-15%) as a stabilizing agent

    • Include protease inhibitors to prevent degradation

  • Multi-step purification approach:

    • Initial affinity chromatography (Ni-NTA for His-tagged protein)

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final polishing

    • Maintain detergent above critical micelle concentration throughout

  • Quality control metrics:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blot confirmation of identity

    • Mass spectrometry verification

    • Enzymatic activity assays

These approaches can be adjusted based on downstream applications and specific experimental requirements.

How does SBH1 integrate into the broader sphingolipid metabolism network in plants?

SBH1 functions as part of a complex sphingolipid metabolism network that influences numerous cellular processes:

  • Biosynthetic pathway position:

    • SBH1 catalyzes hydroxylation of sphingoid bases after their initial synthesis

    • This hydroxylation is prerequisite for subsequent modifications including glycosylation

  • Regulatory implications:

    • SBH1 activity affects the balance between non-hydroxylated and hydroxylated sphingolipids

    • This balance influences membrane properties and signaling capabilities

    • Hydroxylated sphingolipids show different interactions with other membrane components

  • Interconnection with other pathways:

    • Sphingolipid metabolism interconnects with sterol biosynthesis

    • Changes in SBH1 activity can affect broader lipid homeostasis

    • These interactions have implications for stress signaling networks

Understanding this integration requires comprehensive lipidomic approaches combined with transcriptomic and genetic analyses.

What are the key differences between SBH1 function in Arabidopsis and homologous proteins in crop species?

When comparing SBH1 function across plant species, several important differences emerge:

FeatureArabidopsis SBH1Crop HomologsResearch Implications
Gene Copy NumberSingle gene with partial redundancy (SBH2)Often multiple paralogs with specialized functionsRequires careful ortholog identification
Substrate SpecificityRelatively narrow rangeBroader in some species, narrower in othersMay affect experimental design for enzymatic assays
Expression PatternsDocumented in various tissuesOften tissue-specific regulation in cropsTissue sampling considerations for comparative studies
Stress ResponsivenessWell-characterizedVaries significantly between speciesLimit direct extrapolation of stress response findings

These differences highlight the importance of species-specific validation when translating findings from Arabidopsis to crops of agricultural interest.

How do mutations affecting SBH1 impact plant responses to environmental stresses?

While specific data on SBH1 mutations is limited in the search results, we can make informed inferences based on the role of sphingolipids in stress responses and data from related genes:

  • Temperature stress:

    • Altered membrane fluidity and microdomain organization

    • Compromised cold acclimation responses

    • Potentially enhanced heat sensitivity

  • Drought responses:

    • Modified ABA signaling efficiency

    • Altered stomatal regulation

    • Changes in osmotic adjustment capacity

  • Pathogen interactions:

    • Disrupted pathogen-recognition complexes in membranes

    • Modified programmed cell death responses

    • Altered defense signaling pathway activation

For example, mutations in related genes like HOG1 show significant impacts on plant development and viability, suggesting that SBH1 mutations could similarly affect both basal physiology and stress responses .

What are the most reliable methods for measuring SBH1 enzymatic activity in vitro?

Measuring SBH1 enzymatic activity requires specialized approaches:

  • Substrate preparation:

    • Use purified sphingoid bases (commercially available or extracted from plants)

    • Prepare substrate micelles with appropriate detergents

    • Consider fluorescently labeled substrates for higher sensitivity

  • Reaction conditions optimization:

    • Buffer: 50 mM HEPES or phosphate buffer (pH 7.0-7.5)

    • Include cofactors: NADPH, molecular oxygen

    • Add metal ions: Fe²⁺ as potential cofactor

    • Temperature: 25-30°C (balance between stability and activity)

  • Activity detection methods:

    • HPLC separation of substrates and products

    • LC-MS/MS for precise quantification

    • Radioactive assays using ¹⁴C-labeled substrates

    • Coupled enzyme assays monitoring NADPH consumption

  • Data analysis:

    • Calculate enzyme kinetics parameters (Km, Vmax)

    • Compare activity under different conditions

    • Assess inhibitor effects if relevant

These methods can be adapted based on specific research questions and available equipment.

What genetic tools are most effective for studying SBH1 function in vivo?

Several genetic approaches are particularly valuable for investigating SBH1 function in plants:

  • T-DNA insertion and CRISPR-engineered mutants:

    • Enable complete or partial loss-of-function analysis

    • May require careful design if complete knockout is lethal

    • Allow for precise genomic modifications

  • Conditional expression systems:

    • Inducible promoters (like estradiol or dexamethasone-inducible)

    • Tissue-specific promoters for localized manipulation

    • Temperature-sensitive alleles for temporal control

  • Fluorescent protein fusions:

    • N- or C-terminal tags to visualize subcellular localization

    • FRET pairs to study protein-protein interactions

    • Photoconvertible tags for protein dynamics studies

  • Expression profiling tools:

    • Promoter-reporter constructs to monitor expression patterns

    • RNA-seq to identify downstream effects

    • Proteomics to identify interacting partners

These approaches should be complementary, as each provides different insights into SBH1 function.

How should researchers approach contradictory findings in SBH1 functional studies?

When confronting contradictory results in SBH1 research, consider these analytical approaches:

  • Experimental context assessment:

    • Compare precise experimental conditions (temperature, light cycles, growth media)

    • Evaluate plant developmental stages used

    • Consider ecotype/accession differences in Arabidopsis

  • Methodological differences:

    • Examine protein expression systems and purification methods

    • Compare assay conditions and detection techniques

    • Evaluate genetic backgrounds of mutant lines

  • Biological complexity factors:

    • Consider functional redundancy with SBH2

    • Assess potential compensatory mechanisms

    • Evaluate tissue-specific effects that might be masked in whole-plant studies

  • Resolution strategies:

    • Design experiments that directly test competing hypotheses

    • Use multiple independent techniques to verify key findings

    • Perform time-course studies to distinguish primary from secondary effects

For example, contradictions between gene knockout and overexpression studies often arise from compensatory mechanisms or threshold effects that require careful experimental design to resolve.

What are the best practices for analyzing sphingolipid profiles in SBH1 studies?

Comprehensive sphingolipid analysis requires rigorous approaches:

  • Sample preparation considerations:

    • Rapid tissue harvesting and flash-freezing to prevent degradation

    • Complete extraction using appropriate solvent systems

    • Internal standards addition for quantification

    • Careful sample handling to prevent oxidation

  • Analytical methods selection:

    • Untargeted lipidomics for discovery phase

    • Targeted analysis for specific sphingolipid classes

    • Multiple reaction monitoring (MRM) for quantification

    • Ion mobility separation for isomer differentiation

  • Data processing workflow:

    • Signal normalization strategies

    • Missing value imputation considerations

    • Batch effect correction

    • Appropriate transformation (log, centered log-ratio)

  • Statistical analysis approach:

    • Multivariate methods (PCA, PLS-DA)

    • Univariate testing with multiple comparison correction

    • Time-series analysis for developmental studies

    • Integration with transcriptomic or proteomic data

Following these practices ensures robust and reproducible sphingolipid profile analysis in SBH1 functional studies.

How can SBH1 research contribute to improving crop stress tolerance?

Research on SBH1 and sphingolipid metabolism offers several promising avenues for enhancing crop stress tolerance:

  • Knowledge translation pathways:

    • Identify crop orthologs of SBH1 through comparative genomics

    • Characterize expression patterns under various stress conditions

    • Determine structure-function relationships conserved across species

  • Genetic improvement strategies:

    • Engineer optimal sphingolipid hydroxylation levels for stress resilience

    • Develop cultivars with enhanced membrane stability

    • Create varieties with improved signaling pathway efficiency

  • Phenotypic targets for improvement:

    • Drought tolerance through optimized water retention

    • Cold hardiness via membrane composition modification

    • Heat tolerance through stabilized protein-lipid interactions

  • Validation approaches:

    • Field trials under varied environmental conditions

    • Molecular phenotyping of sphingolipid profiles

    • Physiological assessment of stress responses

Similar to observations with other metabolism-related genes, careful genetic manipulation of SBH1 and related enzymes could potentially enhance crop adaptation to changing environmental conditions.

What emerging technologies will advance SBH1 research in the next decade?

Several cutting-edge technologies show particular promise for advancing SBH1 research:

  • Structural biology advances:

    • Cryo-EM for membrane protein structures without crystallization

    • Integrative structural modeling combining multiple data sources

    • AlphaFold2 and related AI approaches for structure prediction

  • Single-cell and spatial biology:

    • Single-cell transcriptomics to identify cell-specific expression patterns

    • Spatial metabolomics to map sphingolipid distributions

    • In situ protein detection with subcellular resolution

  • Genome editing refinements:

    • Base editing for precise point mutations

    • Prime editing for targeted modifications without DSBs

    • Multiplexed CRISPR screens for genetic interaction mapping

  • Advanced imaging approaches:

    • Super-resolution microscopy of membrane microdomains

    • FRET-based biosensors for real-time lipid dynamics

    • Live-cell tracking of lipid metabolism

  • Computational advances:

    • Machine learning for sphingolipid pathway modeling

    • Multi-omics data integration frameworks

    • Molecular dynamics simulations of membrane-protein interactions

These technologies will enable more precise manipulation and analysis of SBH1 function in plant systems, potentially revealing new therapeutic targets for crop improvement.

What are the most common pitfalls when working with recombinant SBH1 and how can they be avoided?

Researchers frequently encounter several challenges when working with recombinant SBH1:

  • Expression and solubility issues:

    • Problem: Formation of inclusion bodies

    • Solution: Lower induction temperature (16-18°C), use solubility tags (MBP, SUMO), optimize codon usage

  • Enzymatic activity loss:

    • Problem: Activity diminishes during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids), minimize freeze-thaw cycles, use appropriate detergents

  • Substrate handling difficulties:

    • Problem: Poor solubility of sphingoid base substrates

    • Solution: Prepare fresh stock solutions, use appropriate detergent micelles, verify substrate quality by HPLC

  • Protein aggregation:

    • Problem: Protein aggregates during storage

    • Solution: Store at appropriate concentration (0.5-1 mg/mL), add stabilizing agents, avoid repeated freeze-thaw

  • Inconsistent activity measurements:

    • Problem: High variability between assays

    • Solution: Standardize reaction conditions, use internal controls, perform technical replicates

Addressing these challenges requires systematic optimization and careful attention to experimental details at each step.

How can researchers validate the specificity of antibodies used in SBH1 research?

Thorough validation of antibodies for SBH1 research requires multiple complementary approaches:

  • Initial validation using multiple samples:

    • Wild-type Arabidopsis extracts

    • Recombinant SBH1 protein (positive control)

    • SBH1 mutant or knockdown lines (negative control)

    • Test for cross-reactivity with SBH2 (specificity control)

  • Technical validation methods:

    • Western blotting (expected MW ~55-60 kDa)

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence with appropriate controls

    • ELISA for quantitative assessments

  • Specificity verification:

    • Peptide competition assays

    • Pre-absorption controls

    • Multiple antibodies targeting different epitopes

    • Genetic knockout confirmation

  • Documentation requirements:

    • Complete details on validation tests performed

    • Lot-to-lot consistency verification

    • Optimal working dilutions for each application

    • Detailed protocols for reproducibility

Comprehensive validation ensures reliable results when using antibodies for detecting and studying SBH1 in various experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.