Recombinant Arabidopsis thaliana Squalene monooxygenase 1,1 (SQP1,1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SQE5; SQP1,1; At5g24150; K12G2.2; Squalene epoxidase 5; AtSQE5; Squalene monooxygenase 1,1; SE 1,1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SQE5
Target Protein Sequence
MAFTNVCLWTLLAFMLTWTVFYVTNRGKKATQLADAVVEEREDGATDVIIVGAGVGGSAL AYALAKDGRRVHVIERDLREPERIMGEFMQPGGRLMLSKLGLEDCLEGIDAQKATGMTVY KDGKEAVASFPVDNNNFPFDPSARSFHNGRFVQRLRQKASSLPNVRLEEGTVKSLIEEKG VIKGVTYKNSAGEETTALAPLTVVCDGCYSNLRRSLNDNNAEVLSYQVGFISKNCQLEEP EKLKLIMSKPSFTMLYQISSTDVRCVFEVLPNNIPSISNGEMATFVKNTIAPQVPLKLRK IFLKGIDEGEHIKAMPTKKMTATLSEKKGVILLGDAFNMRHPAIASGMMVLLSDILILRR LLQPLSNLGNAQKISQVIKSFYDIRKPMSATVNTLGNAFSQVLVASTDEAKEAMRQGCYD YLSSGGFRTSGMMALLGGMNPRPISLIYHLCAITLSSIGHLLSPFPSPLRIWHSLRLFGL AMKMLVPHLKAEGVSQMLFPVNAAAYSKSYMAATAL
Uniprot No.

Target Background

Function
This recombinant *Arabidopsis thaliana* Squalene monooxygenase 1,1 (SQP1,1) catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This enzyme is considered rate-limiting in steroid biosynthesis.
Database Links

KEGG: ath:AT5G24150

STRING: 3702.AT5G24150.1

UniGene: At.411

Protein Families
Squalene monooxygenase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, leaves, stems and inflorescences. Detected in siliques.

Q&A

What is Squalene Monooxygenase 1,1 (SQP1,1) in Arabidopsis thaliana?

SQP1,1 (also known as SQE5, AtSQE5, or At5g24150) is one of several squalene epoxidase enzymes in Arabidopsis thaliana that catalyzes the conversion of squalene to oxidosqualene. This enzyme belongs to a larger family of squalene epoxidases that play essential roles in plant development and metabolism . The protein consists of 516 amino acids and contains characteristic FAD-binding domains essential for its catalytic function . SQP1,1 is just one member of a multi-gene family in Arabidopsis that includes at least six putative squalene epoxidase enzymes, with SQE1, SQE2, and SQE3 being functionally validated for their ability to epoxidize squalene .

What experimental methods are most effective for studying SQP1,1 enzymatic activity?

For effective characterization of SQP1,1 enzymatic activity, researchers should consider:

  • Heterologous Expression Systems: E. coli expression systems have been successfully used to produce recombinant SQP1,1 with N-terminal His tags for purification and functional studies . Yeast complementation assays provide an alternative system where SQE function can be assessed in vivo by complementing yeast strains deficient in endogenous squalene epoxidase activity .

  • Enzymatic Assay Conditions: Optimal conditions include:

    • Buffer: Tris/PBS-based buffer, pH 8.0

    • Temperature: 25-30°C

    • Cofactors: FAD and NADPH are essential

    • Substrate concentration: 50-100 μM squalene

    • Reaction monitoring via HPLC or GC-MS to detect oxidosqualene formation

  • Protein Handling Recommendations:

    • Store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots may be stored at 4°C for up to one week

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

How can researchers distinguish between functional redundancy and specificity among SQE family members?

Research on Arabidopsis squalene epoxidase family members reveals important considerations for distinguishing functional redundancy from specificity:

  • Genetic Approach: Analysis of sqe1 mutants demonstrated that despite the presence of multiple SQE genes, they are not fully redundant. The sqe1-3 and sqe1-4 mutants showed severe developmental defects including reduced root and hypocotyl elongation, diminished stature, and production of inviable seeds . This indicates SQE1 has specific functions not compensated by other family members, including SQP1,1.

  • Expression Pattern Analysis: RT-PCR and in situ hybridization studies of related gene families (such as ASK genes) show that sequence-similar genes tend to have similar expression patterns . Applying similar techniques to SQE family members can reveal tissue-specific or developmental stage-specific expression that may indicate functional specialization.

  • Complementation Testing: Expressing individual SQE genes in sqe1 mutant backgrounds can determine which family members can functionally complement specific phenotypes, helping to distinguish unique versus overlapping functions .

  • Biochemical Characterization: Comparing substrate affinities, catalytic efficiencies, and product profiles of purified recombinant SQE proteins can reveal biochemical specializations that may not be evident from genetic studies alone .

What are the implications of SQP1,1 in triterpenoid biosynthesis compared to other SQE family members?

The role of SQP1,1 in triterpenoid biosynthesis should be considered within the context of the entire SQE family:

SQE Family MemberConfirmed Epoxidase ActivityMajor Phenotypes When DisruptedPotential Specialized Function
SQE1YesReduced root/hypocotyl elongation, diminished stature, inviable seedsPrimary squalene epoxidase for essential sterol biosynthesis
SQE2YesNot fully characterizedPotential redundancy with SQE1 or specialized role
SQE3YesNot fully characterizedPotential redundancy with SQE1 or specialized role
SQE4Not confirmedNot fully characterizedUnknown
SQE5 (SQP1,1)Not directly confirmedNot fully characterizedPotential specialized role in specific tissues or stress conditions
SQE6 (SQP1,2)Not directly confirmedNot fully characterizedPotential specialized role in specific tissues or stress conditions

Research implications:

  • SQE1 functions as the primary squalene epoxidase for essential sterol biosynthesis in Arabidopsis, as evidenced by the accumulation of squalene in sqe1 mutants .

  • The presence of multiple SQE genes suggests potential functional specialization for different metabolic contexts, tissues, or developmental stages.

  • SQP1,1 may have evolved to fulfill specialized roles in triterpenoid metabolism distinct from the main sterol biosynthetic pathway supported by SQE1 .

How should researchers address data contradictions when studying SQP1,1 function?

When confronting contradictory data in SQP1,1 research, consider these methodological approaches:

  • Contradiction Retrieval Methodology: Recent advances in contradiction retrieval utilize novel approaches like SparseCL, which leverages specially trained sentence embeddings to identify contradictory information in research literature. This technique can help researchers efficiently identify and resolve conflicting claims about SQP1,1 function by reducing the need for exhaustive document comparisons to simple vector calculations .

  • Experimental Design Considerations:

    • Use multiple experimental approaches to validate key findings

    • Include appropriate controls for each methodology

    • Test hypotheses across different growth conditions and developmental stages

    • Consider potential differences between in vitro and in vivo systems

  • Common Sources of Contradictions in SQP1,1 Research:

    • Functional redundancy among SQE family members masking phenotypes

    • Developmental or tissue-specific effects

    • Differences in experimental conditions affecting enzyme activity

    • Variations in protein preparation methods impacting functional assessments

  • Resolution Strategies:

    • Cross-validate findings using independent methodologies

    • Conduct time-course and dose-response studies to clarify discrepancies

    • Use genetic approaches (RNAi, CRISPR) alongside biochemical methods

    • Consider using RNA interference approaches to selectively suppress multiple related genes, as done with ASK gene family members

How can RNA interference be applied to study SQP1,1 function in Arabidopsis?

RNA interference (RNAi) offers valuable methodological approaches for studying SQP1,1 function, particularly in the context of potential genetic redundancy:

  • Design Considerations for SQP1,1 RNAi Constructs:

    • Target unique regions of SQP1,1 transcripts to avoid off-target effects on other SQE family members

    • Consider using the Gateway cloning system with pHELLSGATE vectors for efficient RNAi construct generation

    • Design multiple independent constructs targeting different regions of SQP1,1 to validate specificity

  • Lessons from Related Gene Families: Studies of the ASK gene family in Arabidopsis provide valuable precedents. Strong ASK1 RNAi lines exhibited similar or enhanced phenotypes compared to ask1 mutants in both vegetative and floral development, while ASK11 RNAi plants had normal vegetative growth but mild defects in flower development . This demonstrates how RNAi can reveal functional differences among related gene family members.

  • Methodological Approach:

    • Generate transgenic Arabidopsis lines expressing SQP1,1-specific RNAi constructs

    • Confirm silencing efficiency using qRT-PCR to quantify SQP1,1 transcript levels

    • Compare phenotypes with known sqe1 mutants to identify shared versus distinct functions

    • Analyze triterpenoid profiles using GC-MS or LC-MS to identify specific metabolic impacts

  • Combined Approaches: For more comprehensive analysis, RNAi targeting of SQP1,1 can be combined with mutations in other SQE genes to address potential functional redundancy .

What methodologies are recommended for phenotypic analysis of plants with altered SQP1,1 expression?

Based on studies of related genes like SQE1 and gene families like ASK, researchers should employ these methodologies for comprehensive phenotypic analysis:

What structural features are important for SQP1,1 function and how can they be studied?

Key structural features of SQP1,1 and methodological approaches for their study include:

  • Important Structural Elements:

    • FAD-binding domain: Critical for catalytic activity

    • Transmembrane domains: The N-terminal region contains hydrophobic segments indicative of membrane association

    • Substrate binding pocket: Determines specificity for squalene

    • Catalytic residues: Essential for the epoxidation reaction

  • Experimental Approaches:

    • Site-directed mutagenesis of conserved residues to determine their importance

    • Protein truncation studies to identify minimal functional domains

    • Homology modeling based on related enzymes with known structures

    • Crystallization trials with purified recombinant protein

  • Sequence Comparison Analysis: Alignment of SQP1,1 with other SQE family members such as SQP1,2 (SQE6) reveals regions of high conservation that likely represent functionally critical domains . Regions with greater sequence divergence may contribute to functional specialization among family members.

  • Heterologous Expression Systems: E. coli expression systems have been successfully used to produce SQP1,1 with N-terminal His tags , providing a platform for structural studies including:

    • Protein purification optimization

    • Stability studies under various buffer conditions

    • Ligand binding assays

    • Enzymatic activity characterization

How does post-translational modification impact SQP1,1 function?

While specific data on SQP1,1 post-translational modifications is limited in the provided search results, research on related enzymes suggests several important considerations:

  • Potential Modifications:

    • Phosphorylation: May regulate enzyme activity or protein-protein interactions

    • Glycosylation: Could affect protein stability or localization

    • Ubiquitination: May regulate protein turnover, potentially through SCF complexes

  • SCF Complex Involvement: The Arabidopsis SKP1-like (ASK) gene family, which includes 21 members, plays critical roles in SCF complexes that facilitate the ligation of ubiquitin to specific proteins . Given that protein degradation by the ubiquitin-proteasome system regulates many biological processes in plants, SQP1,1 function may be controlled in part through interaction with SCF complexes.

  • Investigative Approaches:

    • Mass spectrometry to identify and map post-translational modifications

    • Phospho-specific antibodies to detect phosphorylation events

    • Mutagenesis of predicted modification sites to assess functional impacts

    • Co-immunoprecipitation studies to identify interactions with components of the SCF complex

  • Methodological Recommendations: When studying potential post-translational regulation of SQP1,1, researchers should consider:

    • Tissue-specific and developmental timing of modifications

    • Environmental conditions that may trigger regulatory changes

    • Protein extraction methods that preserve labile modifications

    • Use of phosphatase or proteasome inhibitors during protein isolation

What are the optimal conditions for expressing and purifying recombinant SQP1,1?

Based on available data for recombinant SQP1,1 production , researchers should consider these methodological approaches:

  • Expression System Optimization:

    • E. coli has been successfully used for recombinant SQP1,1 production

    • Consider BL21(DE3) or Rosetta strains for improved expression

    • Optimize induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-30°C), and duration (4-24 hours)

    • Alternative systems like insect cells may improve folding of membrane-associated proteins

  • Protein Tagging Strategy:

    • N-terminal His-tag has been successfully employed

    • Consider testing different tag positions (N vs. C-terminal) to optimize functional expression

    • TEV or PreScission protease cleavage sites can facilitate tag removal if needed

  • Purification Protocol:

    • Initial capture: Ni-NTA affinity chromatography

    • Secondary purification: Ion exchange or size exclusion chromatography

    • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been successful

    • Consider detergent screening if membrane association affects solubility

  • Storage and Stability:

    • Lyophilization has been used successfully for SQP1,1

    • For liquid storage, add 5-50% glycerol and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots may be stored at 4°C for up to one week

How can researchers troubleshoot common issues in SQP1,1 activity assays?

When conducting enzymatic assays with recombinant SQP1,1, researchers may encounter several challenges that require methodological solutions:

  • Low Activity Issues:

    • Verify protein folding using circular dichroism or fluorescence spectroscopy

    • Ensure cofactors (FAD, NADPH) are fresh and at appropriate concentrations

    • Test different buffer compositions, particularly varying pH (7.0-8.5)

    • Consider adding stabilizing agents such as glycerol or trehalose

    • Verify substrate quality and solubility (squalene is highly hydrophobic)

  • Product Detection Challenges:

    • Optimize extraction methods for oxidosqualene (consider different organic solvents)

    • Develop sensitive HPLC or GC-MS methods with appropriate standards

    • Consider derivatization to improve detection sensitivity

    • Use radiolabeled substrates for increased sensitivity in challenging assays

  • Interfering Factors:

    • Test for the presence of inhibitors in the protein preparation

    • Consider the impact of detergents if used during purification

    • Run appropriate controls to identify background activity

    • Validate assay specificity using heat-inactivated enzyme controls

  • Experimental Design Recommendations:

    • Include positive controls using commercially available epoxidases

    • Perform time-course experiments to identify optimal reaction times

    • Establish substrate saturation curves to determine kinetic parameters

    • Test multiple reaction temperatures to identify the optimal range

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.