Recombinant Arabidopsis thaliana Squalene monooxygenase 1,2 (SQP1,2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SQE6; SQP1,2; At5g24160; K12G2.4; Squalene epoxidase 6; AtSQE6; Squalene monooxygenase 1,2; SE 1,2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-517
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SQE6
Target Protein Sequence
MAFTHVCLWTLVAFVLTWTVFYLTNMKKKATDLADTVAEDQKDGAADVIIVGAGVGGSAL AYALAKDGRRVHVIERDMREPERMMGEFMQPGGRLMLSKLGLQDCLEDIDAQKATGLAVY KDGKEADAPFPVDNNNFSYEPSARSFHNGRFVQQLRRKAFSLSNVRLEEGTVKSLLEEKG VVKGVTYKNKEGEETTALAPLTVVCDGCYSNLRRSLNDDNNAEIMSYIVGYISKNCRLEE PEKLHLILSKPSFTMVYQISSTDVRCGFEVLPENFPSIANGEMSTFMKNTIVPQVPPKLR KIFLKGIDEGAHIKVVPAKRMTSTLSKKKGVIVLGDAFNMRHPVVASGMMVLLSDILILR RLLQPLSNLGDANKVSEVINSFYDIRKPMSATVNTLGNAFSQVLIGSTDEAKEAMRQGVY DYLCSGGFRTSGMMALLGGMNPRPLSLVYHLCAITLSSIGQLLSPFPSPLRIWHSLKLFG LAMKMLVPNLKAEGVSQMLFPANAAAYHKSYMAATTL
Uniprot No.

Target Background

Function
Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This enzyme is considered rate-limiting in steroid biosynthesis.
Database Links

KEGG: ath:AT5G24160

STRING: 3702.AT5G24160.1

UniGene: At.409

Protein Families
Squalene monooxygenase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, leaves, stems, inflorescences and siliques.

Q&A

What is the function of Squalene monooxygenase in Arabidopsis thaliana?

Squalene monooxygenase (also called squalene epoxidase) catalyzes the conversion of squalene into oxidosqualene, which serves as the precursor for all known angiosperm cyclic triterpenoids. These include essential membrane sterols, brassinosteroid phytohormones, and non-steroidal triterpenoids. This enzymatic conversion represents a critical step in the triterpenoid biosynthetic pathway in plants .

The reaction specifically involves the epoxidation of squalene, adding an oxygen atom to form 2,3-oxidosqualene. This reaction requires molecular oxygen, NADPH, and FAD. The resulting oxidosqualene then undergoes cyclization by oxidosqualene cyclases to form various triterpenoid skeletons that serve as precursors for downstream sterol biosynthesis.

How many SQE/SQP family members exist in Arabidopsis thaliana?

Arabidopsis thaliana contains six putative squalene epoxidase (SQE) enzymes. Through heterologous expression studies in yeast, researchers have confirmed that three of these enzymes—SQE1, SQE2, and SQE3—demonstrate the ability to epoxidize squalene . The additional members include SQE5 (also called SQP1,1) and SQE6 (also called SQP1,2) .

Recent phylogenetic analyses have further refined our understanding of this gene family, distinguishing between true SQEs and a subfamily of SQE-like proteins that appears to be exclusive to Brassicaceae . This distinction is important when considering evolutionary relationships and potentially divergent functions among family members.

What phenotypes result from mutations in SQE family genes?

Mutations in SQE1 result in severe developmental defects, including:

  • Reduced root and hypocotyl elongation

  • Diminished adult plant stature

  • Production of inviable seeds

  • Accumulation of squalene (consistent with a block in the triterpenoid biosynthetic pathway)

These findings indicate that SQE1 function is necessary for normal plant development despite the presence of five other SQE-like genes, suggesting incomplete functional redundancy among family members. Similarly, sqe3-1 mutants accumulate squalene and display sensitivity to terbinafine (an SQE inhibitor), indicating that SQE3 contributes significantly to the bulk SQE activity in Arabidopsis . SQE3 appears to play a particularly important role in embryo development.

How can researchers effectively characterize SQP1,2 enzyme activity in vitro?

Characterizing SQP1,2 enzyme activity requires a multi-faceted approach:

  • Heterologous expression systems: Express recombinant SQP1,2 in suitable systems like E. coli, yeast, baculovirus, or mammalian cells . Yeast expression systems are particularly valuable as they can be engineered to lack endogenous squalene epoxidase activity.

  • Enzyme assays: Measure squalene epoxidase activity by quantifying the conversion of radiolabeled or stable isotope-labeled squalene to 2,3-oxidosqualene. The reaction requires NADPH, FAD, and oxygen.

  • Kinetic parameters determination: Calculate Km and Vmax values for SQP1,2 using varied substrate concentrations. This allows comparison with other SQE family members to assess potential functional differences.

  • Inhibitor studies: Test sensitivity to known squalene epoxidase inhibitors like terbinafine to characterize pharmacological responses. Differential sensitivity compared to other SQE family members may reveal structural or functional distinctions.

When examining squalene epoxidase activity, it is critical to account for potential SQE-SQLE complex formation, as evidence suggests that endogenous squalene derived from farnesyl diphosphate is preferred over exogenous squalene as a substrate for squalene epoxidase in microsomes .

What are the recommended approaches for creating and validating SQP1,2 mutants?

Creating and validating SQP1,2 mutants requires careful experimental design:

  • Mutant generation strategies:

    • T-DNA insertion lines from established Arabidopsis stock centers

    • CRISPR-Cas9 genome editing for precise mutations

    • RNAi-mediated knockdown if complete loss-of-function is lethal

  • Comprehensive validation protocol:

    • Genotyping to confirm mutation at the DNA level

    • RT-qPCR to verify reduced/absent transcript expression

    • Western blotting to confirm protein absence/reduction

    • Metabolite profiling to assess squalene accumulation and downstream sterol depletion

  • Phenotypic characterization:

    • Development analysis (germination, root elongation, hypocotyl growth)

    • Stress responses, particularly to conditions affecting membrane integrity

    • Embryo development assessment

    • Complementation studies with wild-type SQP1,2 to confirm phenotype causality

  • Functional redundancy testing:

    • Generate double or triple mutants with other SQE family members

    • Express SQP1,2 in sqe1 or sqe3 mutant backgrounds to test for complementation

How should researchers design experiments to study SQP1,2 regulation?

Investigating SQP1,2 regulation requires multiple experimental approaches:

  • Transcriptional regulation:

    • RNA-seq or microarray analysis to identify conditions affecting expression

    • Promoter analysis using reporter gene constructs to identify cis-regulatory elements

    • ChIP assays to identify transcription factors binding the promoter

    • Analysis of SQP1,2 expression across tissues and developmental stages

  • Post-transcriptional regulation:

    • Assessment of mRNA stability under different conditions

    • Investigation of alternative splicing patterns

    • Analysis of potential miRNA-mediated regulation

  • Post-translational regulation:

    • Protein stability studies using cycloheximide chase assays

    • Identification of post-translational modifications using mass spectrometry

    • Analysis of protein-protein interactions affecting enzyme activity or localization

  • Metabolic regulation:

    • Feedback inhibition studies with downstream products

    • Assessment of regulation by phytohormones

    • Quantification of enzyme activity under different metabolic states

When studying regulation, it's important to consider the C-terminal region of squalene synthase (SQS), as research has shown this region may be involved in channeling squalene through the sterol pathway .

What is the subcellular localization of SQP1,2 and how can it be determined?

Based on studies of related family members, SQE proteins typically localize to the endoplasmic reticulum (ER). Specifically, both SQE1 and SQE3 have been demonstrated to localize to the ER . To determine SQP1,2 localization:

  • Fluorescent protein fusion approaches:

    • Generate N- and C-terminal GFP/YFP fusions with SQP1,2

    • Express in Arabidopsis or transient expression systems

    • Visualize using confocal microscopy

    • Co-localize with established organelle markers

  • Biochemical fractionation:

    • Perform subcellular fractionation to isolate organelles

    • Detect SQP1,2 using specific antibodies in Western blotting

    • Compare distribution with known organelle marker proteins

  • Immunolocalization:

    • Use SQP1,2-specific antibodies for immunogold labeling

    • Visualize localization using electron microscopy

When studying localization, consider that membrane-bound enzymes in the sterol pathway often form functional complexes. Evidence suggests potential interaction between squalene synthase (SQS) and squalene epoxidase (SQLE) in microsomes, which affects substrate channeling .

What techniques are most effective for studying SQP1,2 protein-protein interactions?

Several complementary approaches can effectively identify and characterize SQP1,2 protein-protein interactions:

  • Yeast two-hybrid (Y2H) screening:

    • Use SQP1,2 as bait to screen Arabidopsis cDNA libraries

    • Validate positive interactions with directed Y2H assays

    • Consider membrane-specific Y2H systems for membrane-associated proteins

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of SQP1,2 in plants or heterologous systems

    • Immunoprecipitate using tag-specific antibodies

    • Identify co-precipitating proteins by mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse SQP1,2 and candidate interactors to complementary fragments of fluorescent proteins

    • Observe reconstituted fluorescence upon interaction in planta

    • Assess subcellular localization of interaction simultaneously

  • Proximity-dependent labeling:

    • Fuse SQP1,2 to BioID or APEX2 enzymes

    • Express in plant cells and activate labeling

    • Identify proximal proteins by affinity purification and mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions with appropriate spectral properties

    • Measure energy transfer indicative of protein proximity

    • Provides dynamic information about interactions in living cells

When studying protein interactions, specifically investigate potential interactions with other enzymes in the sterol biosynthetic pathway. Research suggests the formation of metabolic complexes that facilitate substrate channeling, particularly between SQS and SQLE .

How can researchers analyze functional redundancy among SQE family members?

Analyzing functional redundancy among SQE family members requires a systematic approach:

  • Expression pattern analysis:

    • Compare transcript levels across tissues and developmental stages

    • Assess expression under stress conditions and hormone treatments

    • Look for complementary or overlapping expression patterns

  • Genetic complementation studies:

    • Express each SQE family member in sqe1 or sqe3 mutant backgrounds

    • Quantify the degree of phenotype rescue for each complementation

    • For example, studies have shown that SQE3 can functionally complement SQE1

  • Mutant combination analysis:

    • Generate single, double, and higher-order mutants

    • Compare phenotypic severity across mutant combinations

    • Identify synthetic interactions suggesting partially redundant functions

  • Biochemical characterization:

    • Compare substrate specificity and enzyme kinetics

    • Assess sensitivity to inhibitors

    • Determine subcellular localization and protein-protein interactions

  • Domain swap experiments:

    • Create chimeric proteins with domains from different SQE family members

    • Test functionality in complementation assays

    • Identify domains responsible for specific functions or regulations

The available research already indicates that while there are six SQE-like genes in Arabidopsis, they are not fully redundant. Despite the presence of multiple SQE family members, the sqe1 mutant still exhibits severe developmental defects , and sqe3-1 mutants accumulate squalene .

What is the phylogenetic relationship between SQP1,2 and other SQE family members?

Recent phylogenetic analyses have provided important insights into the evolutionary relationships among SQE family members:

  • True SQEs vs. SQE-like proteins:

    • Phylogenetic studies have resolved a distinction between true SQEs and a subfamily of SQE-like proteins

    • The SQE-like subfamily appears to be exclusive to Brassicaceae

  • Functional conservation:

    • SQE1, SQE2, and SQE3 have confirmed squalene epoxidase activity through heterologous expression in yeast

    • SQE1 and SQE3 appear to be functionally related, as SQE3 can complement SQE1

  • Structural features:

    • Analysis of conserved domains and motifs can provide insights into function

    • Comparison with SQEs from other organisms reveals evolutionary conservation

  • Gene duplication history:

    • Some SQE genes appear to be organized in tandem arrays, suggesting recent duplication events

    • For example, SQS1 and SQS2 in Arabidopsis are organized in a tandem array with identical intron positions and exon sizes

When conducting phylogenetic analyses, researchers should consider both sequence similarity and functional conservation, as sequence similarity alone may not always predict functional equivalence.

How should researchers interpret contradictory data regarding SQP1,2 function?

When faced with contradictory data regarding SQP1,2 function, researchers should:

  • Evaluate experimental conditions:

    • Compare growth conditions, developmental stages, and tissues analyzed

    • Assess differences in genetic backgrounds used

    • Consider environmental variables that might influence results

  • Examine methodological differences:

    • Compare protein expression systems (E. coli, yeast, baculovirus, or mammalian cells)

    • Evaluate enzyme assay conditions and detection methods

    • Consider differences in mutation types (knockout vs. knockdown)

  • Address potential gene redundancy:

    • Determine if other SQE family members compensate in different experimental setups

    • Consider tissue-specific or condition-specific redundancy

  • Validate key findings independently:

    • Reproduce critical experiments using multiple approaches

    • Use both in vitro and in vivo systems to confirm observations

    • Verify results using multiple biological and technical replicates

  • Integrate multiple data types:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Use computational models to integrate contradictory findings

    • Consider systems biology approaches to understand network effects

When interpreting data, remember that SQE1 function has been shown to be essential despite the presence of other SQE family members , suggesting complex interactions and potentially specialized functions among family members.

What statistical approaches are recommended for analyzing SQP1,2 expression data?

Analyzing SQP1,2 expression data requires appropriate statistical methods:

  • Normalization strategies:

    • Use established reference genes for qRT-PCR data normalization

    • Apply appropriate normalization methods for RNA-seq data (FPKM, TPM, or DESeq2)

    • Consider batch effect correction for datasets from multiple experiments

  • Differential expression analysis:

    • Use parametric tests (t-test, ANOVA) for normally distributed data

    • Apply non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal data

    • For RNA-seq, use specialized tools like DESeq2, edgeR, or limma-voom

  • Multiple testing correction:

    • Apply Benjamini-Hochberg procedure to control false discovery rate

    • Consider family-wise error rate control for strict hypothesis testing

    • Report both raw and adjusted p-values for transparency

  • Co-expression analysis:

    • Use Pearson or Spearman correlation to identify co-expressed genes

    • Apply clustering methods to identify expression modules

    • Consider weighted gene co-expression network analysis (WGCNA)

  • Temporal expression analysis:

    • Use time series analysis methods for developmental studies

    • Consider autocorrelation in time series data

    • Apply functional data analysis for continuous trajectories

When analyzing expression data, be aware that SQE family members may show tissue-specific expression patterns. For example, SQS1 mRNA has been detected in all plant tissues but is especially abundant in roots .

How can SQP1,2 be utilized in metabolic engineering of plant sterol pathways?

Utilizing SQP1,2 in metabolic engineering requires strategic approaches:

When engineering sterol pathways, consider the potential importance of protein-protein interactions. Research suggests the formation of enzyme complexes that facilitate substrate channeling, particularly between SQS and SQLE .

What emerging technologies could advance our understanding of SQP1,2 function?

Several emerging technologies hold promise for advancing our understanding of SQP1,2:

  • CRISPR-based approaches:

    • Prime editing for precise sequence modifications

    • CRISPRi/CRISPRa for tunable gene expression control

    • CRISPR screens to identify genetic interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize enzyme complexes

    • Label-free imaging to track sterol distribution

    • Live-cell imaging to monitor dynamic protein interactions

  • Single-cell omics:

    • Single-cell RNA-seq to capture cell-specific expression patterns

    • Single-cell proteomics to identify cell-type-specific protein interactions

    • Spatial transcriptomics to map expression in tissue context

  • Structural biology advances:

    • Cryo-EM for membrane protein structure determination

    • Integrative structural modeling combining multiple data types

    • Molecular dynamics simulations to understand enzyme mechanics

  • Synthetic biology tools:

    • Optogenetic control of SQP1,2 activity

    • Biosensors to monitor pathway intermediates in real-time

    • Minimal synthetic pathways to study enzyme function in isolation

These technologies could help resolve questions about SQP1,2's role in the context of the entire SQE family and provide insights into how the enzymes function within the sterol biosynthetic pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.