Recombinant Arabidopsis thaliana Squalene monooxygenase 2 (SQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SQE4; SQP2; At5g24140; MLE8.6; Squalene epoxidase 4; AtSQE4; Squalene monooxygenase 2; SE 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SQE4
Target Protein Sequence
MTYAWLWTLLAFVLTWMVFHLIKMKKAATGDLEAEAEARRDGATDVIIVGAGVAGASLAY ALAKDGRRVHVIERDLKEPQRFMGELMQAGGRFMLAQLGLEDCLEDIDAQEAKSLAIYKD GKHATLPFPDDKSFPHEPVGRLLRNGRLVQRLRQKAASLSNVQLEEGTVKSLIEEEGVVK GVTYKNSAGEEITAFAPLTVVCDGCYSNLRRSLVDNTEEVLSYMVGYVTKNSRLEDPHSL HLIFSKPLVCVIYQITSDEVRCVAEVPADSIPSISNGEMSTFLKKSMAPQIPETGNLREI FLKGIEEGLPEIKSTATKSMSSRLCDKRGVIVLGDAFNMRHPIIASGMMVALSDICILRN LLKPLPNLSNTKKVSDLVKSFYIIRKPMSATVNTLASIFSQVLVATTDEAREGMRQGCFN YLARGDFKTRGLMTILGGMNPHPLTLVLHLVAITLTSMGHLLSPFPSPRRFWHSLRILAW ALQMLGAHLVDEGFKEMLIPTNAAAYRRNYIATTTV
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Squalene monooxygenase 2 (SQP2): Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, a rate-limiting step in steroid biosynthesis.

Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed mainly in seedlings and inflorescences.

Q&A

What is Arabidopsis thaliana Squalene monooxygenase 2 and how does it differ from other SQP enzymes?

Arabidopsis thaliana Squalene monooxygenase 2 (SQP2) is an enzyme that catalyzes the epoxidation of squalene to 2,3-oxidosqualene, which serves as a precursor for all known angiosperm cyclic triterpenoids, including membrane sterols, brassinosteroid phytohormones, and non-steroidal triterpenoids .

In Arabidopsis, there are six putative squalene epoxidase (SQE) enzymes, with SQE2 (also known as SQP2) being one of three (along with SQE1/SQP1 and SQE3/SQP3) that have been experimentally verified to have squalene epoxidation activity through heterologous expression in yeast .

SQP2 differs from other SQP enzymes primarily in its expression pattern and functional redundancy. While SQE1/SQP1 appears essential for normal plant development (with mutants showing severe developmental defects), the other five SQE-like genes, including SQP2, are not fully redundant with SQE1 . This suggests SQP2 may have specialized functions or expression patterns distinct from other family members.

What is the molecular structure and key functional domains of recombinant SQP2?

The full-length Arabidopsis thaliana SQP proteins contain approximately 517 amino acids . While we don't have the specific sequence data for SQP2 in these search results, related SQP proteins, such as SQP1, consist of several key functional domains:

  • FAD-binding domain: Essential for the enzyme's oxidative function

  • Substrate-binding domain: Responsible for squalene recognition

  • Membrane-association regions: Facilitate localization to the endoplasmic reticulum

The recombinant versions used in research typically include affinity tags (such as His-tags) fused to either the N-terminus or C-terminus to facilitate purification .

How do researchers express and purify recombinant Arabidopsis thaliana SQP2?

Expression and purification of recombinant Arabidopsis thaliana SQP2 typically follows this methodological approach:

  • Expression System Selection: E. coli is commonly used for expression of plant proteins . For SQP2, bacterial expression systems are preferred due to ease of genetic manipulation and high protein yield.

  • Vector Construction: The full-length coding sequence (approximately 1-517 amino acids) is cloned into an expression vector with an appropriate promoter and tag (typically His-tag) .

  • Expression Conditions: Optimal expression conditions include:

    • IPTG induction (typically 0.1-1.0 mM)

    • Growth temperature of 16-25°C

    • Induction period of 16-24 hours

  • Purification Protocol:

    • Cell lysis via sonication or pressure homogenization

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Optional secondary purification using ion-exchange or size-exclusion chromatography

    • Elution in Tris/PBS-based buffer, often with 6% Trehalose, pH 8.0

  • Storage: The purified protein is typically stored as a lyophilized powder or in liquid form with 50% glycerol at -20°C or -80°C .

How can researchers differentiate between the functions of SQP1, SQP2, and other SQP family members in Arabidopsis?

Differentiating between the functions of various SQP family members requires multiple complementary approaches:

  • Expression Pattern Analysis:

    • Utilize promoter-reporter constructs (similar to the SMAP2 promoter analysis) to determine tissue-specific expression patterns

    • Employ qRT-PCR to quantify expression levels across different tissues and developmental stages

    • Compare expression patterns under various stress conditions

  • Mutant Analysis:

    • Generate single, double, and higher-order mutants of SQP genes

    • Characterize developmental phenotypes as observed in sqe1 mutants (reduced root and hypocotyl elongation, diminished stature, seed viability issues)

    • Quantify biochemical changes (squalene accumulation, sterol profiles)

  • Complementation Studies:

    • Express individual SQP genes in sqp mutant backgrounds to assess functional redundancy

    • Test cross-species complementation using SQP genes from other plant species

  • Biochemical Characterization:

    • Express each SQP protein in heterologous systems to compare enzyme kinetics

    • Assess substrate specificity using purified recombinant proteins

  • Subcellular Localization:

    • Determine precise localization of each SQP family member using fluorescent protein fusions

    • Identify potential differential compartmentalization that might explain non-redundant functions

Research has shown that while SQE1/SQP1 is essential for normal development, the other five SQE-like genes (including SQP2) are not fully redundant , suggesting distinct but potentially overlapping functions.

What are the optimal conditions for assessing SQP2 enzymatic activity in vitro?

The optimization of in vitro SQP2 enzymatic activity assays requires careful consideration of multiple parameters:

ParameterOptimal RangeNotes
pH7.0-8.0Tris-HCl or phosphate buffer
Temperature25-30°CEnzyme stability decreases above 35°C
CofactorsFAD (5-20 μM)
NADPH (0.1-1.0 mM)
O₂
All three cofactors are essential
SubstrateSqualene (10-100 μM)Solubilized in mild detergent
DetergentTriton X-100 (0.1-0.5%)
or
Tween-20 (0.1-0.5%)
Critical for substrate solubilization
Reaction time30-60 minutesLinear reaction rate maintained
Protein concentration0.1-1.0 mg/mLHigher concentrations may cause aggregation

For product detection and quantification:

  • HPLC Analysis:

    • C18 reverse-phase column

    • Mobile phase: Acetonitrile/water gradient

    • UV detection at 210 nm

  • GC-MS Analysis:

    • Derivatization of 2,3-oxidosqualene may be required

    • HP-5MS column or equivalent

    • Temperature gradient from 150°C to 300°C

  • Radiometric Assay:

    • ¹⁴C-labeled squalene as substrate

    • Extraction of products using organic solvents

    • Quantification via liquid scintillation counting

The presence of reducing agents (DTT or β-mercaptoethanol) at 1-5 mM may help maintain enzyme activity during longer incubations by preventing oxidation of critical cysteine residues.

How does the functional role of SQP2 change under various abiotic stress conditions?

The role of SQP2 under abiotic stress conditions likely involves complex regulatory mechanisms that affect triterpenoid biosynthesis:

  • Drought Stress:

    • Increased sterol and brassinosteroid biosynthesis may enhance membrane stability

    • SQP2 expression and activity might be upregulated to support increased flux through the pathway

    • Potential coordination with stress-responsive kinases like SnRK2 family proteins

  • Salt Stress:

    • Altered sterol composition in membranes helps maintain ionic homeostasis

    • SQP2 activity may be post-translationally modified to adjust pathway flux

    • Temporal expression changes correlate with adaptive responses

  • Temperature Stress:

    • Cold stress typically increases membrane sterol content to maintain fluidity

    • Heat stress may require rapid adjustments in sterol composition

    • SQP2 regulation likely occurs at both transcriptional and post-translational levels

  • Oxidative Stress:

    • As SQP2 utilizes oxygen for catalysis, its activity may be sensitive to ROS levels

    • Triterpenoid derivatives with antioxidant properties may be produced as protective mechanisms

    • Regulatory cross-talk with redox-sensing pathways

Methodological approaches to study these changes include:

  • RNA-seq and qRT-PCR analysis of SQP2 expression under stress conditions

  • Metabolomic profiling to track changes in sterol and triterpenoid content

  • Protein interaction studies to identify stress-specific regulatory partners

  • Use of fluorescent reporters to track real-time changes in SQP2 expression or localization

The SnRK2 family of protein kinases, which are key components of abscisic acid (ABA) signaling and osmotic stress responses , may potentially interact with or regulate SQP2 function under stress conditions, creating an integrated stress response mechanism.

What are the best approaches for analyzing SQP2 gene expression patterns in different tissues and developmental stages?

A comprehensive analysis of SQP2 gene expression requires multiple complementary techniques:

  • Promoter-Reporter Fusion Analysis:

    • Clone the SQP2 promoter region (1-2 kb upstream of start codon)

    • Create promoter::GUS or promoter::GFP constructs

    • Transform Arabidopsis and analyze expression patterns

    • Consider multiple promoter lengths to identify key regulatory elements (as demonstrated with SMAP2)

  • Quantitative RT-PCR:

    • Design gene-specific primers that distinguish SQP2 from other family members

    • Collect tissues at different developmental stages

    • Use reference genes with stable expression across conditions

    • Normalize expression data using multiple reference genes

  • RNA-seq Analysis:

    • Perform transcriptome sequencing of different tissues/stages

    • Use bioinformatic tools to extract SQP2-specific expression data

    • Conduct co-expression analysis to identify functionally related genes

  • In Situ Hybridization:

    • Design SQP2-specific RNA probes

    • Analyze cellular-level expression in tissue sections

    • Particularly useful for reproductive tissues and developing organs

The expression analysis of SMAP2 showed tissue-specific patterns, with strong expression in specific tissues . Similar approaches can be applied to SQP2, comparing different promoter fragment lengths (e.g., 2 kb vs 1 kb) to identify key regulatory regions that drive expression in specific tissues or developmental contexts.

How can researchers effectively generate and characterize SQP2 knockout or knockdown lines in Arabidopsis?

Generation and characterization of SQP2 mutant lines requires systematic approaches:

  • CRISPR/Cas9-Based Knockout Generation:

    • Design sgRNAs targeting conserved domains of SQP2

    • Transform Arabidopsis using floral dip method

    • Screen transformants via sequencing

    • Confirm knockout at protein level via western blot

  • T-DNA Insertion Line Identification:

    • Search public databases (TAIR, NASC) for available T-DNA lines in SQP2

    • Verify insertion position and homozygosity using PCR

    • Confirm knockdown/knockout via RT-PCR and western blot

  • RNAi/amiRNA Knockdown Approach:

    • Design construct targeting unique regions of SQP2

    • Generate stable transformants with different levels of knockdown

    • Verify specificity by checking expression of other SQP genes

  • Mutant Characterization Protocol:

Analysis TypeMethodsParameters to Measure
PhenotypicGrowth measurements
Microscopy
Developmental timing
Root/hypocotyl length
Plant height
Leaf area
Flowering time
Seed production
BiochemicalGC-MS
LC-MS
TLC
Squalene levels
2,3-oxidosqualene levels
Sterol/triterpenoid profiles
TranscriptomicRNA-seq
qRT-PCR
Expression changes in:
- Other SQP genes
- Downstream sterol biosynthesis genes
- Related metabolic pathways
PhysiologicalDrought tolerance assay
Salt tolerance test
Hormone sensitivity
Water loss rate
Survival percentage
Growth inhibition
  • Higher-Order Mutant Generation:

    • Cross SQP2 mutants with other SQP family mutants

    • Generate double, triple mutants to address redundancy

    • Phenotype increasingly severe combinations to understand functional hierarchy

When characterizing sqp2 mutants, it's important to consider the developmental defects observed in sqe1 mutants (reduced root and hypocotyl elongation, diminished stature, seed viability) and determine whether sqp2 shows similar or distinct phenotypes.

What are the critical considerations for using recombinant SQP2 in protein-protein interaction studies?

Protein-protein interaction studies with recombinant SQP2 require careful attention to several critical factors:

  • Protein Preparation Considerations:

    • Express full-length protein (1-517 amino acids) to preserve all interaction domains

    • Consider both N-terminal and C-terminal tagged versions (tag position may affect interactions)

    • Ensure proper folding through controlled expression conditions

    • Verify enzymatic activity before interaction studies

    • Store properly to maintain native conformation (avoid repeated freeze-thaw cycles)

  • Interaction Detection Methods Comparison:

MethodAdvantagesLimitationsKey Considerations for SQP2
Yeast Two-HybridHigh-throughput
In vivo detection
Membrane proteins challenging
False positives
Use as bait against cDNA library
Verify interactions via multiple methods
Co-ImmunoprecipitationDetects native complexes
Preserves cellular context
Requires antibodies
Transient interactions missed
Use anti-His antibodies for tagged SQP2
Include appropriate controls
Pull-down AssaysDirect interaction testing
Controlled conditions
May miss weak interactions
Non-physiological conditions
Use His-tagged SQP2 with Ni-NTA resin
Optimize buffer conditions
Surface Plasmon ResonanceQuantitative kinetics
Label-free detection
Requires purified proteins
Technical expertise needed
Immobilize SQP2 via His-tag
Test multiple buffer compositions
FRET/BiFCIn vivo visualization
Spatial information
Fusion proteins required
Potential artifacts
Consider SQP2 orientation and linker length
Include appropriate controls
  • Buffer and Environmental Considerations:

    • Include mild detergents (0.1% Triton X-100) to maintain membrane protein solubility

    • Provide cofactors (FAD, NADPH) to stabilize native conformation

    • Test multiple pH conditions (pH 7.0-8.0) to optimize interactions

    • Include protease inhibitors to prevent degradation

    • Consider the presence of substrate or substrate analogs

  • Candidate Interaction Partners:

    • Regulatory kinases (potentially SnRK2 family members)

    • Other enzymes in the sterol biosynthetic pathway

    • Membrane anchor proteins

    • Stress-responsive proteins

    • Transcription factors regulating terpenoid metabolism

  • Validation Approaches:

    • Confirm interactions using multiple independent methods

    • Perform domain mapping to identify specific interaction regions

    • Test interaction under various conditions (stress, developmental stages)

    • Use in vivo approaches (BiFC, FRET) to confirm cellular relevance

What are the most promising future research directions for understanding SQP2 function in Arabidopsis?

The most promising research directions for advancing our understanding of SQP2 function in Arabidopsis include:

  • Comparative Functional Analysis:

    • Systematic comparison of all six SQP family members to identify unique vs. redundant functions

    • Development of higher-order mutants to fully address functional redundancy

    • Cross-species complementation to understand evolutionary conservation

  • Regulatory Network Mapping:

    • Identification of transcription factors controlling SQP2 expression

    • Elucidation of post-translational modifications affecting SQP2 activity

    • Integration of SQP2 regulation with plant hormone signaling networks

    • Potential connections with stress-response pathways involving SnRK2 kinases

  • Metabolic Engineering Applications:

    • Manipulation of SQP2 expression to enhance production of valuable triterpenoids

    • Creation of SQP2 variants with altered catalytic properties

    • Use of SQP2 promoters for tissue-specific expression of transgenes

  • Stress Adaptation Mechanisms:

    • Detailed characterization of SQP2 roles under specific abiotic stresses

    • Identification of stress-specific protein interactions or modifications

    • Development of strategies to enhance plant stress tolerance through SQP2 modulation

  • Advanced Structural Biology:

    • Determination of high-resolution SQP2 crystal structure

    • Molecular dynamics simulations to understand catalytic mechanism

    • Structure-guided approaches to engineer enzyme properties

These research directions will contribute to our fundamental understanding of triterpenoid biosynthesis regulation in plants and potentially open new avenues for crop improvement and specialized metabolite production.

How should researchers address contradictory findings regarding SQP2 function across different experimental systems?

When addressing contradictory findings regarding SQP2 function, researchers should implement a systematic approach:

  • Experimental System Comparison:

    • Directly compare in vitro (recombinant protein) vs. in vivo (plant) results

    • Evaluate effects of expression systems (E. coli, yeast, plant) on protein activity

    • Consider heterologous vs. native cellular environments

  • Methodological Standardization:

    • Develop standardized protocols for enzyme activity assays

    • Establish common phenotyping approaches for mutant analysis

    • Create reference materials (antibodies, constructs) for community use

  • Context-Dependent Function Analysis:

    • Systematically test SQP2 function across developmental stages

    • Evaluate activity under various stress conditions

    • Assess tissue-specific roles using promoter studies similar to those done for SMAP2

  • Collaborative Meta-Analysis:

    • Organize data-sharing initiatives across research groups

    • Perform statistical meta-analysis of published results

    • Address publication bias through pre-registration of experiments

  • Technological Resolution:

    • Apply emerging technologies (single-cell transcriptomics, CRISPR screening)

    • Develop more sensitive analytical methods for metabolite detection

    • Implement mathematical modeling to reconcile seemingly contradictory data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.