Recombinant Arabidopsis thaliana Squalene synthase (SQS1)

Shipped with Ice Packs
In Stock

Description

Introduction

Squalene synthase (SQS) is an enzyme that catalyzes the first committed step in sterol biosynthesis . It facilitates the condensation of two molecules of farnesyl diphosphate (FPP) to produce squalene (SQ) . Squalene is a precursor for sterols, triterpenoids, and brassinosteroids . In Arabidopsis thaliana, the SQS1 gene encodes the primary functional squalene synthase .

Gene Organization and Expression

Arabidopsis thaliana has two squalene synthase genes, SQS1 (At4g34640) and SQS2 (At4g34650), arranged in a tandem array . The SQS1 gene is expressed widely in all tissues during plant development . The SQS2 gene is mainly expressed in the vascular tissue of leaf and cotyledon petioles, and the hypocotyl of seedlings .

Functional Analysis of SQS Isoforms

Studies have shown that SQS1 is the only functional SQS in A. thaliana . The complete A. thaliana SQS2 protein is unable to confer ergosterol prototrophy to a Saccharomyces cerevisiae erg9 mutant strain lacking SQS activity . A soluble form of SQS2 expressed in Escherichia coli was unable to synthesize squalene from FPP in the presence of NADPH and either $$Mg^{2+}$$ or $$Mn^{2+}$$ .

Subcellular Localization

The SQS1 enzyme is targeted to the endoplasmic reticulum (ER) membrane . This localization depends on the presence of the SQS1 C-terminal hydrophobic trans-membrane domain .

Cloning and Characterization of SQS1 Gene

A full-length Arabidopsis thaliana SQS cDNA has been isolated through library screening and PCR-based approaches . SQS1 and SQS2 have an identical organization regarding intron positions and exon sizes and encode SQS isoforms showing high sequence conservation (79% identity and 88% similarity) .

Expression Analysis

RNA blot analysis has shown that the 1.6-kb SQS1 mRNA is detected in all plant tissues analyzed, such as inflorescences, leaves, stems, and roots, although the transcript is especially abundant in roots .

Role of C-Terminal Region

Labeling studies using $$^3H$$farnesyl-P2 and microsomal fractions obtained from yeast strains expressing either Arabidopsis SQS1 or chimeric Arabidopsis/S. pombe SQS derivatives indicated that the C-terminal region of the enzyme is involved in channeling squalene through the yeast sterol pathway .

SQS1 Function

SQS1 catalyzes the condensation of 2 farnesyl pyrophosphate (FPP) moieties to form squalene .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SQS1; At4g34640; T4L20.220; Squalene synthase 1; SQS 1; SS 1; FPP:FPP farnesyltransferase 1; Farnesyl-diphosphate farnesyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SQS1
Target Protein Sequence
MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMD QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGLGL SKLFLAAGSEVLTPDWEAISNSMGLFLQKTNIIRDYLEDINEIPKSRMFWPREIWGKYAD KLEDLKYEENTNKSVQCLNEMVTNALMHIEDCLKYMVSLRDPSIFRFCAIPQIMAIGTLA LCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDKNDPNASKTLN RLEAVQKLCRDAGVLQNRKSYVNDKGQPNSVFIIMVVILLAIVFAYLRAN
Uniprot No.

Target Background

Gene References Into Functions
  1. In Arabidopsis thaliana, SQS1 is the sole functional squalene synthase. PMID: 18236008
Database Links

KEGG: ath:AT4G34640

STRING: 3702.AT4G34640.1

UniGene: At.20898

Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues analyzed (seedlings, cotyledons, inflorescences, siliques, leaves, stems and roots). Highly expressed in roots and pollen.

Q&A

What is the biochemical function of Arabidopsis thaliana SQS1?

Arabidopsis thaliana Squalene Synthase 1 (SQS1) catalyzes the first committed step of the sterol biosynthetic pathway by condensing two molecules of farnesyl diphosphate (FPP) to produce squalene (SQ). This reaction occurs through a two-step process with presqualene diphosphate (PSPP) serving as a stable reaction intermediate. Squalene is a crucial precursor for sterol, brassinosteroid, and triterpene biosynthesis in plants. The enzyme plays a central role in directing carbon flux toward the sterol pathway, which is essential for membrane structure and plant hormone production .

How is the SQS1 gene organized in the Arabidopsis thaliana genome?

Arabidopsis thaliana contains two SQS-annotated genomic sequences, At4g34640 (SQS1) and At4g34650 (SQS2), organized in a tandem array on chromosome 4. Both genes share identical organization with regard to intron positions and exon sizes, suggesting they arose through gene duplication. Despite their structural similarities, they encode SQS isoforms with different expression patterns and functionality. The SQS1 gene produces a 1.6-kb mRNA transcript that is detectable in all plant tissues, although it is particularly abundant in root tissues .

What is the difference between SQS1 and SQS2 in Arabidopsis thaliana?

While SQS1 and SQS2 share considerable sequence homology (79% identity and 88% similarity at the protein level), they differ significantly in functionality and expression patterns:

  • Functionality: SQS1 is the only functionally active squalene synthase in A. thaliana. Despite its structural similarity, SQS2 has no detectable squalene synthase activity.

  • Expression pattern: SQS1 is widely expressed throughout plant development in all tissues, while SQS2 expression is primarily restricted to the vascular tissue of leaf and cotyledon petioles, and the hypocotyl of seedlings.

  • Protein structure: A key difference is the presence of an unusual serine residue in SQS2 that replaces a highly conserved phenylalanine (at position 287) found in SQS1, although this alone does not fully explain SQS2's lack of activity .

What is the subcellular localization of SQS1 and how can it be experimentally determined?

Arabidopsis thaliana SQS1 is targeted to the endoplasmic reticulum (ER) membrane. This subcellular localization can be experimentally determined using GFP-tagged versions of SQS1 expressed in model plant cells such as onion epidermal cells. Research has demonstrated that SQS1's ER membrane targeting is exclusively dependent on the presence of its C-terminal hydrophobic transmembrane domain. When this domain is removed or replaced, the localization pattern changes significantly .

For experimental verification of SQS1 localization, researchers should:

  • Create fusion constructs with SQS1 and a fluorescent reporter (like GFP)

  • Express these constructs in plant cells through transient transformation

  • Observe the subcellular distribution using confocal microscopy

  • Use appropriate ER markers for co-localization studies

  • Perform domain deletion/substitution experiments to verify the role of specific protein regions in targeting

How does the expression pattern of SQS1 vary across different tissues and developmental stages?

For comprehensive expression analysis, researchers can employ:

  • qRT-PCR to quantify transcript levels across tissues and developmental stages

  • Promoter-reporter gene fusions (e.g., SQS1 promoter::GUS) to visualize spatial and temporal expression patterns

  • RNA-seq for genome-wide expression profiling in different conditions

  • In situ hybridization to localize expression at the cellular level

What experimental approaches can be used to produce and purify recombinant SQS1?

To produce and purify recombinant Arabidopsis thaliana SQS1, researchers can employ several complementary approaches:

Bacterial Expression Systems:

  • Clone the SQS1 cDNA into appropriate E. coli expression vectors (e.g., pET series)

  • Express a soluble form of SQS1 by removing the C-terminal membrane anchor

  • Optimize expression conditions (temperature, IPTG concentration, growth media)

  • Purify using affinity chromatography (His-tag, GST-tag) followed by size-exclusion chromatography

  • Verify activity using in vitro enzymatic assays with [³H]farnesyl-P₂ as substrate

Yeast Expression Systems:

  • Clone SQS1 into yeast expression vectors

  • Transform into SQS-defective Saccharomyces cerevisiae strains (e.g., strain 5302)

  • Assess functional complementation through ergosterol prototrophy assays

  • Isolate microsomal fractions for activity assays

  • Consider creating chimeric constructs with yeast C-terminal domains for improved functionality

Why doesn't Arabidopsis SQS1 complement SQS-defective yeast strains despite showing enzymatic activity?

Arabidopsis thaliana SQS1 shows an interesting functional paradox: it demonstrates enzymatic activity in the microsomal fraction of transformed yeast strains but fails to complement SQS-defective Saccharomyces cerevisiae strain 5302. This discrepancy points to important structural and functional differences between plant and yeast SQS enzymes.

The key factor appears to be the C-terminal region of the enzyme. Research has shown that a chimeric SQS created by replacing the 66 C-terminal residues of Arabidopsis SQS1 with the 111 C-terminal residues of Schizosaccharomyces pombe SQS can successfully confer ergosterol prototrophy to the yeast strain 5302. This suggests that the C-terminal region is crucial for proper channeling of squalene through the yeast sterol pathway .

Specifically, the C-terminal region appears to facilitate an interaction between SQS and the next enzyme in the pathway, squalene epoxidase (SQLE). Without the appropriate C-terminal domain, Arabidopsis SQS1 can produce squalene, but this squalene cannot be efficiently utilized by the subsequent yeast enzymes in the sterol pathway .

What methodologies can be used to assess SQS1 enzymatic activity in vitro and in vivo?

In vitro activity assays:

  • Microsomal fraction preparation from recombinant expression systems

  • Radioisotope assays using [³H]farnesyl-P₂ as substrate

  • NADPH-dependent activity measurements with either Mg²⁺ or Mn²⁺ as cofactors

  • Analysis of reaction products by thin-layer chromatography (TLC)

  • Kinetic parameter determination (Km, Vmax) under varying substrate concentrations

In vivo functional analysis:

  • Complementation studies in SQS-defective yeast strains

  • Analysis of squalene and sterol content by GC-MS or LC-MS in transgenic plants

  • RNAi or CRISPR-based gene silencing followed by metabolite profiling

  • Antisense oligonucleotides (AsODNs) to inhibit SQS1 expression

  • Overexpression studies to assess pathway flux alteration

  • Labeling studies with ¹³C or ³H-labeled precursors to track metabolic flux

What role does the C-terminal region of SQS1 play in enzyme function and interaction with other pathway components?

The C-terminal region of Arabidopsis thaliana SQS1 serves several critical functions beyond merely anchoring the enzyme to the ER membrane:

  • Metabolic channeling: The C-terminal domain is instrumental in the channeling of squalene through the sterol biosynthetic pathway. Research comparing Arabidopsis SQS1 with chimeric Arabidopsis/S. pombe SQS derivatives has demonstrated that the C-terminal region facilitates the efficient transfer of squalene to the next enzyme in the pathway .

  • Protein-protein interactions: There is compelling evidence for an important interaction between SQS and squalene epoxidase (SQLE). Studies have shown that in yeast microsomes, exogenous squalene is a poor substrate for yeast SQLE compared to endogenously produced squalene from farnesyl diphosphate. This suggests the formation of an SQS/SQLE complex in microsomes that enables efficient substrate channeling .

  • Membrane targeting: The C-terminal hydrophobic transmembrane domain is exclusively responsible for targeting SQS1 to the ER membrane. This localization is crucial for proper integration into the sterol biosynthetic pathway, which is primarily localized to the ER .

Experimentally, these functions can be investigated through domain swapping, site-directed mutagenesis, protein-protein interaction studies (yeast two-hybrid, co-immunoprecipitation), and subcellular co-localization analyses .

How do specific amino acid residues affect SQS1 catalytic activity?

Specific amino acid residues play critical roles in determining the catalytic activity of Arabidopsis thaliana SQS1. By comparing the functional SQS1 with the inactive SQS2 and other species' SQS enzymes, researchers have identified key residues that impact enzyme function:

  • Position 287: In SQS2, an unusual serine residue replaces the highly conserved phenylalanine found at position 287 in SQS1 and other functional SQS enzymes. While this substitution contributes to SQS2's lack of activity, mutational studies have revealed it is not the sole determinant, suggesting multiple critical residues are involved in the catalytic mechanism .

  • Conserved domains: SQS enzymes contain several highly conserved domains required for substrate binding, catalysis, and structural integrity. Comparative analysis of SQS sequences from diverse organisms can help identify these essential residues.

  • Active site residues: The active site of SQS contains specific residues that coordinate cofactors (NADPH, Mg²⁺ or Mn²⁺) and interact with the substrate (FPP).

For experimental analysis of critical residues, researchers can employ:

  • Site-directed mutagenesis of conserved residues

  • Expression of mutant proteins and assessment of activity

  • Structural modeling based on crystallographic data from related enzymes

  • Kinetic analysis of wild-type and mutant proteins

How does SQS1 activity integrate with broader isoprenoid and sterol metabolism in plants?

SQS1 occupies a pivotal position at the branch point of isoprenoid metabolism in plants, directing carbon flux specifically toward sterol, brassinosteroid, and triterpene biosynthesis. Its integration with broader metabolism involves:

  • Upstream regulation: SQS1 catalyzes the first committed step in sterol biosynthesis, condensing two molecules of farnesyl diphosphate (FPP). FPP is a central intermediate in isoprenoid metabolism that can be channeled into various pathways, including sesquiterpene synthesis, protein prenylation, and dolichol production. SQS1 activity therefore represents a key regulatory point for controlling flux into the sterol pathway .

  • Downstream impacts: Squalene produced by SQS1 serves as the precursor for phytosterols (including campesterol and sitosterol), brassinosteroids (such as brassinolide and castasterone), and various triterpenes. These compounds have diverse functions in membrane structure, hormone signaling, and stress responses .

  • Crosstalk with hormone pathways: Research has shown that squalene and its derivatives interact with multiple hormone pathways. For example, squalene impacts brassinosteroid (BR) biosynthesis, with genes involved in BR biosynthesis being up-regulated when squalene synthesis is inhibited. Additionally, the BR signaling components BZR1 and BES1 can regulate cold response genes, creating complex regulatory networks .

  • Stress response connections: Squalene acts as a feedback signaling molecule in facilitating plant responses to environmental stresses, particularly cold stress. It influences the expression of stress-responsive transcription factors like CBF5 and interacts with the brassinosteroid pathway to modify stress tolerance .

What are the implications of SQS1 activity for plant development and stress responses?

SQS1 activity has significant implications for both plant development and stress responses due to its role in sterol and brassinosteroid biosynthesis:

Developmental impacts:

  • Membrane structure and function: Sterols produced downstream of SQS1 are essential components of plasma membranes, affecting membrane fluidity, permeability, and the formation of specialized membrane domains.

  • Brassinosteroid signaling: Brassinosteroids derived from the sterol pathway regulate numerous developmental processes, including cell elongation, vascular differentiation, and reproductive development.

Stress response regulation:

  • Cold stress tolerance: Squalene produced by SQS1 functions as a feedback signaling molecule that can improve cold resistance in plants. This occurs partially through the induction of CsCBF5, a transcription factor in the cold-response pathway .

  • Brassinosteroid-mediated stress responses: Castasterone (CS), a bioactive brassinosteroid derived from the sterol pathway, accumulates in plants exposed to squalene or low temperatures. CS positively influences enzyme activities and reduces reactive oxygen species (ROS) accumulation during stress .

  • Membrane integrity under stress: Sterols help maintain membrane integrity during temperature fluctuations, contributing to stress tolerance.

For experimental investigation of these roles, researchers can employ:

  • Transcriptomic analysis of SQS1-silenced or overexpression lines

  • Metabolite profiling under various stress conditions

  • Analysis of brassinosteroid content and signaling in SQS1-modified plants

  • Phenotypic characterization under developmental and stress conditions

How can recombinant SQS1 be utilized for metabolic engineering of high-value isoprenoids?

Recombinant Arabidopsis thaliana SQS1 offers significant potential for metabolic engineering applications aimed at producing high-value isoprenoids and sterols:

Strategic approaches:

  • Pathway flux manipulation: Modulating SQS1 expression levels can redirect carbon flux between competing isoprenoid pathways. For example, downregulating SQS1 could potentially increase flux toward sesquiterpenes or other FPP-derived compounds, while overexpression might enhance sterol and triterpene production.

  • Enzyme engineering: Creating chimeric enzymes that combine the catalytic properties of Arabidopsis SQS1 with membrane-interaction domains from other organisms (similar to the Arabidopsis/S. pombe chimeras) could enhance productivity in heterologous expression systems.

  • Multi-enzyme complexes: Co-expressing SQS1 with downstream enzymes (such as squalene epoxidase) could facilitate metabolic channeling, improving the efficiency of target compound production.

  • Synthetic biology approaches: Designing artificial metabolic pathways that incorporate modified SQS1 variants with altered substrate specificity or product profiles.

Methodological considerations:

  • Select appropriate expression systems (plant cells, yeast, or bacteria)

  • Optimize subcellular targeting using appropriate signal sequences

  • Consider removing the membrane-binding domain for soluble expression

  • Engineer the C-terminal domain to enhance interaction with downstream enzymes

  • Employ metabolic flux analysis to identify pathway bottlenecks

What are the current challenges in studying SQS1 structure-function relationships?

Several significant challenges exist in the comprehensive study of SQS1 structure-function relationships:

  • Membrane protein crystallization: As an ER membrane-associated protein, obtaining crystal structures of full-length SQS1 is technically challenging. Most structural insights have been inferred from sequence homology, mutagenesis studies, and partial structures.

  • Complex regulatory mechanisms: SQS1 is regulated at multiple levels (transcriptional, post-transcriptional, and post-translational), making it difficult to isolate specific structure-function relationships from the broader regulatory context.

  • Multi-enzyme complexes: Evidence suggests SQS1 functions within larger enzyme complexes or metabolons in the sterol pathway. Studying the protein in isolation may not capture the full range of its functional interactions.

  • Heterologous expression limitations: Functional expression of plant SQS1 in microbial systems presents challenges, as demonstrated by the inability of Arabidopsis SQS1 to complement yeast SQS mutants despite having enzymatic activity.

  • Dynamic protein-membrane interactions: The interaction between SQS1 and the ER membrane is likely dynamic and regulated, adding another layer of complexity to structure-function studies.

Future research directions:

  • Cryo-electron microscopy for membrane protein structural analysis

  • In situ structural studies using newer techniques like proximity labeling

  • Molecular dynamics simulations to understand protein-membrane interactions

  • Advanced protein engineering approaches to create functional variants with improved properties

  • Systems biology approaches to understand SQS1 in its broader metabolic context

How do post-translational modifications regulate SQS1 activity in different physiological contexts?

Post-translational modifications (PTMs) likely play crucial roles in regulating SQS1 activity, although this aspect remains less thoroughly characterized than other features of the enzyme:

Potential regulatory PTMs:

  • Phosphorylation: Many metabolic enzymes are regulated by phosphorylation events that can rapidly alter activity in response to cellular signals. Phosphorylation sites may be present in SQS1 regulatory domains.

  • Redox regulation: Cysteine residues in SQS1 could be subject to oxidation/reduction, providing a mechanism to respond to cellular redox status and stress conditions.

  • Protein-protein interactions: Interaction with regulatory proteins may modify SQS1 activity in response to developmental or environmental cues.

  • Membrane microdomain association: The distribution of SQS1 within ER membrane microdomains may regulate its activity by controlling substrate accessibility and interaction with pathway partners.

Research methodologies:

  • Phosphoproteomic analysis of SQS1 under different conditions

  • Site-directed mutagenesis of putative modification sites

  • In vitro activity assays with purified SQS1 under various redox conditions

  • Co-immunoprecipitation studies to identify interacting proteins

  • Subcellular fractionation and membrane microdomain analysis

This area represents a promising frontier for future research, potentially revealing dynamic regulatory mechanisms that coordinate SQS1 activity with plant development and stress responses .

How do SQS enzymes from Arabidopsis compare with those from other plants and fungi in terms of structure and function?

Comparative analysis of squalene synthases across species reveals important insights into evolutionary conservation and functional divergence:

Structural comparisons:

  • C-terminal domains: A significant difference exists in the C-terminal regions of plant and fungal SQS enzymes. Research has identified a sequence of approximately 30 amino acids present in the C-terminal region of yeasts (Saccharomyces cerevisiae and Schizosaccharomyces pombe) that is absent in plant, rat, mouse, and human SQSs. This region appears crucial for proper channeling of squalene into the sterol pathway .

  • Catalytic domains: The catalytic core of SQS is highly conserved across species, reflecting the fundamental importance of the reaction catalyzed.

  • Membrane-binding domains: All SQS enzymes contain C-terminal hydrophobic domains for membrane association, but these vary in length and composition between species.

Functional comparisons:

  • Enzymatic properties: While the basic catalytic function is conserved, kinetic parameters and cofactor preferences may vary between species.

  • Subcellular localization: SQS enzymes from different organisms are generally targeted to the ER membrane, but the specific targeting mechanisms may differ.

  • Pathway integration: The functional interaction with downstream enzymes varies significantly, as evidenced by the inability of Arabidopsis SQS1 to properly channel squalene into the yeast sterol pathway without a yeast C-terminal domain .

This comparative approach provides valuable insights for engineering SQS enzymes with desired properties for biotechnological applications and offers evolutionary perspectives on sterol pathway development across kingdoms .

What can be learned from SQS1 and SQS2 gene duplication in Arabidopsis about the evolution of metabolic enzymes?

The tandem duplication that produced SQS1 and SQS2 in Arabidopsis thaliana provides a fascinating case study in the evolution of metabolic enzymes following gene duplication:

Evolutionary insights:

  • Functional divergence: Despite their high sequence similarity (79% identity, 88% similarity), SQS1 retains full enzymatic activity while SQS2 has lost catalytic function. This represents a clear case of subfunctionalization or neofunctionalization following duplication .

  • Expression divergence: The genes show distinct expression patterns, with SQS1 widely expressed and SQS2 restricted primarily to vascular tissues. This suggests regulatory evolution following duplication, potentially allowing for tissue-specific optimization of sterol metabolism .

  • Selective pressures: The maintenance of both genes in the genome despite SQS2's lack of catalytic activity suggests it may have evolved a different function or regulatory role.

Key factors in functional divergence:

  • Critical residue changes: The replacement of a conserved phenylalanine with serine at position 287 in SQS2 contributes to its inactivity, although this change alone does not fully explain the loss of function .

  • Regulatory evolution: Changes in promoter regions have led to distinct expression patterns, potentially reflecting adaptation to different developmental or environmental contexts.

Broader implications:

  • Gene duplication provides raw material for metabolic innovation

  • Functional divergence can occur rapidly through key amino acid substitutions

  • Expression pattern changes may be as important as coding sequence changes

  • Non-catalytic duplicated enzymes may acquire regulatory or structural roles

What are the most effective approaches for engineering SQS1 to modulate sterol and triterpene biosynthesis in transgenic plants?

Engineering SQS1 for modulating sterol and triterpene biosynthesis in transgenic plants requires sophisticated approaches that address both enzyme activity and pathway integration:

Strategic engineering approaches:

  • Expression level manipulation:

    • Overexpression using strong constitutive or tissue-specific promoters

    • RNAi or CRISPR-based gene silencing for reduced activity

    • Inducible expression systems for temporal control

    • Antisense oligonucleotides (AsODNs) for transient inhibition

  • Protein engineering:

    • Site-directed mutagenesis to alter catalytic efficiency or regulatory properties

    • Domain swapping with SQS enzymes from other species

    • Creation of chimeric enzymes with optimized properties

    • Modification of the C-terminal region to enhance or alter pathway channeling

  • Subcellular targeting:

    • Altered membrane targeting to change enzyme accessibility to substrates

    • Co-localization with other pathway enzymes to facilitate metabolic channeling

Experimental validation methods:

  • Metabolite profiling using GC-MS or LC-MS to quantify sterols and triterpenes

  • Transcriptomic analysis to assess pathway-wide effects

  • Phenotypic characterization under various conditions

  • Isotope labeling studies to track metabolic flux

  • Protein-protein interaction studies to assess pathway integration

How can advanced imaging techniques be used to study SQS1 localization and dynamics in living cells?

Advanced imaging techniques offer powerful approaches for studying SQS1 localization, dynamics, and interactions in living cells:

State-of-the-art imaging approaches:

  • Fluorescent protein fusions:

    • GFP-tagged SQS1 for basic localization studies

    • Photoactivatable or photoswitchable fluorescent proteins to track protein movement

    • Split fluorescent protein systems to study protein-protein interactions

    • Multicolor imaging to examine co-localization with other pathway components

  • Super-resolution microscopy:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

    • These techniques can resolve structures below the diffraction limit, enabling visualization of SQS1 distribution within ER subdomains

  • Live-cell dynamics:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Fluorescence correlation spectroscopy (FCS) to analyze diffusion characteristics

    • Single-particle tracking to follow individual molecules

  • Protein-protein interactions:

    • Förster resonance energy transfer (FRET) to detect interactions with pathway partners

    • Bimolecular fluorescence complementation (BiFC) to visualize protein complexes

    • Proximity ligation assay (PLA) for high-sensitivity detection of interactions

Experimental design considerations:

  • Use appropriate controls to distinguish specific from non-specific localization

  • Verify that fluorescent tags do not disrupt protein function

  • Combine multiple techniques for comprehensive analysis

  • Consider employing recently developed plant-optimized fluorescent proteins

What expression vectors and host systems are most suitable for producing active recombinant SQS1?

Selecting appropriate expression vectors and host systems is crucial for obtaining active recombinant Arabidopsis thaliana SQS1:

Expression vectors:

  • Bacterial expression vectors:

    • pET series vectors with T7 promoter for high-level expression

    • pGEX vectors for GST-fusion proteins that may improve solubility

    • pMAL vectors for MBP-fusion proteins to enhance solubility

    • Vectors with removable tags through precision protease sites

  • Yeast expression vectors:

    • pYES2 for galactose-inducible expression in S. cerevisiae

    • pPICZ for methanol-inducible expression in Pichia pastoris

    • Vectors designed for complementation of erg9 (SQS-defective) yeast strains

  • Plant expression vectors:

    • Binary vectors for Agrobacterium-mediated transformation

    • Vectors with plant-optimized codons and appropriate regulatory elements

    • Vectors enabling transient expression for rapid testing

Host systems:

  • Bacterial systems (E. coli):

    • BL21(DE3) for general recombinant protein expression

    • Rosetta or CodonPlus strains for improved expression of plant proteins

    • C41/C43 strains specifically designed for membrane protein expression

    • Consider expressing a truncated, soluble form lacking the membrane-binding domain

  • Yeast systems:

    • S. cerevisiae erg9 mutant strains for functional complementation studies

    • Pichia pastoris for potentially higher expression levels and proper folding

    • Consider chimeric constructs with yeast C-terminal domains for functional expression

  • Plant-based systems:

    • Nicotiana benthamiana for transient expression

    • Arabidopsis thaliana for stable transformation and homologous expression

    • BY-2 or other plant cell cultures for scaled protein production

What analytical methods are most informative for characterizing SQS1 enzyme kinetics and substrate specificity?

Comprehensive characterization of SQS1 enzyme kinetics and substrate specificity requires a combination of analytical approaches:

Kinetic analysis methods:

  • Radioisotope assays:

    • Incubation with [³H]farnesyl-P₂ followed by organic extraction and scintillation counting

    • Time-course analysis to determine initial reaction rates

    • Substrate concentration series for Km and Vmax determination

    • Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analysis

  • Spectrophotometric assays:

    • NADPH consumption monitoring at 340 nm

    • Coupled enzyme assays for continuous measurement

    • Microplate-based formats for higher throughput

  • Chromatographic methods:

    • HPLC separation of reaction products

    • GC-MS or LC-MS for product identification and quantification

    • TLC analysis with appropriate standards

Substrate specificity analysis:

  • Alternative substrate testing:

    • Natural and synthetic FPP analogs

    • Substrate analogs with modified chain length or saturation

    • Labeled substrates for product analysis

  • Inhibitor studies:

    • Competitive and non-competitive inhibitors

    • Mechanism-based inhibitors

    • Structure-activity relationship analysis

Advanced biophysical methods:

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

  • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Differential scanning fluorimetry for protein stability assessment

  • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

Data analysis considerations:

  • Use appropriate enzyme kinetic models (Michaelis-Menten, Hill, etc.)

  • Account for membrane effects when using full-length protein

  • Consider potential allosteric regulation

  • Compare parameters with SQS enzymes from other species

How might SQS1 be involved in plant communication and stress signaling networks?

Recent research suggests intriguing roles for SQS1 and its product squalene in plant communication and stress signaling networks:

Stress signaling mechanisms:

  • Cold stress response: Squalene has been identified as a feedback signaling molecule that facilitates plant responses to cold stress. When applied exogenously, squalene can improve cold tolerance through specific signaling pathways .

  • Transcriptional regulation: Squalene influences the expression of key stress-responsive transcription factors, particularly CsCBF5 (a member of the CBF/DREB1 family), which plays a crucial role in cold-response pathways .

  • Hormone crosstalk: Squalene interacts with the brassinosteroid signaling pathway, affecting the accumulation of castasterone (CS), a bioactive brassinosteroid. This interaction creates a complex regulatory network linking sterol metabolism with stress responses .

Plant communication roles:

  • Volatile signaling: Squalene may be released as a volatile compound from plants under certain conditions, such as insect damage or flowering. This suggests potential roles in plant defense against insects or in attracting pollinators .

  • Membrane properties: Sterols derived from squalene contribute to membrane structure and function, potentially affecting signal perception and transduction.

  • Systemic signaling: The study of tea plants suggests that squalene may participate in systemic signaling networks that transmit stress information throughout the plant.

Experimental approaches to investigate these roles:

  • Volatile collection and analysis from plants under various stress conditions

  • Transcriptomic profiling of plants exposed to exogenous squalene

  • Metabolomic analysis of sterol pathway intermediates during stress responses

  • Plant-to-plant communication experiments with SQS1-silenced plants

  • Analysis of membrane properties in relation to signaling complex formation

What are the unexplored potential applications of recombinant SQS1 in synthetic biology and metabolic engineering?

Recombinant Arabidopsis thaliana SQS1 offers several unexplored opportunities in synthetic biology and metabolic engineering:

Novel pathway engineering:

  • Production of rare or modified sterols: Engineering SQS1 and downstream enzymes could enable production of uncommon phytosterols with pharmaceutical potential.

  • Triterpene scaffold diversification: Combining engineered SQS1 with various oxidosqualene cyclases could generate novel triterpene scaffolds as starting points for bioactive compound development.

  • Terpenoid pathway optimization: Strategic manipulation of SQS1 expression or activity could redirect carbon flux between competing terpenoid pathways, enhancing production of desired compounds.

Enzyme engineering frontiers:

  • Substrate scope expansion: Engineering SQS1 to accept modified substrates could enable production of novel squalene analogs with unique properties.

  • Improved catalytic efficiency: Directed evolution or rational design approaches could enhance SQS1 activity, stability, or tolerance to industrial conditions.

  • Designer protein-protein interactions: Engineering the C-terminal domain could create novel metabolic channeling capabilities with non-native pathway partners.

Emerging applications:

  • Biosensors: SQS1-based biosensors could detect pathway intermediates or environmental signals affecting isoprenoid metabolism.

  • Biocatalytic systems: Immobilized or engineered SQS1 could serve as a biocatalyst for industrial squalene production.

  • Synthetic signaling networks: Exploiting squalene's signaling properties could enable design of synthetic stress response circuits in plants or other organisms.

  • Metabolic modeling platforms: SQS1 and the branched isoprenoid pathway represent an ideal model system for studying and engineering complex metabolic networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.