Recombinant Arabidopsis thaliana Sterol 14-demethylase (CYP51G1)

Shipped with Ice Packs
In Stock

Description

Function and Importance

CYP51, a cytochrome P450 monooxygenase, catalyzes the removal of the 14α-methyl group from sterols, a critical step in sterol biosynthesis . This enzyme facilitates the conversion of lanosterol to its demethylated product . The absence of sterol 14α-demethylase activity or disruption of ergosterol synthesis can compromise the integrity and function of the fungal cell membrane, thereby inhibiting fungal growth .

Discovery and Characterization

The gene encoding sterol 14α-demethylase, known as ERG11 in Candida albicans, has been identified and characterized across various species . Phylogenetic analysis reveals that CYP51 enzymes are highly conserved from bacteria to humans .

Expression and Purification

CYP51 can be heterologously expressed in Escherichia coli and purified for in vitro studies . The purified enzyme exhibits a typical reduced CO-difference spectrum, with a maximum absorbance at 446 nm . Reconstitution with NADPH-P450 reductase enables the conversion of lanosterol to its demethylated product .

Inhibition by Azole Antifungal Agents

Azole antifungal agents, such as econazole, fluconazole, ketoconazole, and itraconazole, bind tightly to CYP51, inhibiting its activity . Mutations in CYP51 can affect azole drug binding affinity, potentially leading to drug resistance .

Role in Plant Growth and Development

In Arabidopsis thaliana, CYP51A2 plays a crucial role in plant growth and development by a sterol-dependent mechanism .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP51G1; CYP51A2; EMB1738; At1g11680; F25C20.17; Sterol 14-demethylase; Cytochrome P450 51A2; Cytochrome P450 51G1; AtCYP51; Obtusifoliol 14-demethylase; Protein EMBRYO DEFECTIVE 1738
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP51G1
Target Protein Sequence
MELDSENKLLKTGLVIVATLVIAKLIFSFFTSDSKKKRLPPTLKAWPPLVGSLIKFLKGP IIMLREEYPKLGSVFTVNLVHKKITFLIGPEVSAHFFKASESDLSQQEVYQFNVPTFGPG VVFDVDYSVRQEQFRFFTEALRVNKLKGYVDMMVTEAEDYFSKWGESGEVDIKVELERLI ILTASRCLLGREVRDQLFDDVSALFHDLDNGMLPISVLFPYLPIPAHRRRDRAREKLSEI FAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHTSSITSTWT GAYLMRYKEYFSAALDEQKNLIAKHGDKIDHDILSEMDVLYRCIKEALRLHPPLIMLMRA SHSDFSVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGA FSYIAFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELVSPFPEIDWNAMVVGVKGNVMV RYKRRQLS
Uniprot No.

Target Background

Function

This protein is involved in sterol biosynthesis. Specifically, it catalyzes the 14-alpha demethylation of obtusifoliol to 4 alpha-methyl-5 alpha-ergosta-8,14,24(28)-trien-3 beta-ol.

Gene References Into Functions
  1. Membrane sterol content and composition changes in the cyp51A2 mutant induce oxidant and ethylene generation, leading to premature seedling senescence. PMID: 19915013
  2. The Arabidopsis CYP51A2 gene encodes a functional obtusifoliol 14alpha-demethylase, playing a crucial role in plant growth and development via a sterol-specific pathway. PMID: 16040657
Database Links

KEGG: ath:AT1G11680

STRING: 3702.AT1G11680.1

UniGene: At.22780

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in leaves, roots, stems, siliques, flowers, flower buds and seedlings.

Q&A

What is CYP51G1 and what is its function in Arabidopsis thaliana?

CYP51G1 (also known as CYP51A2) is an essential cytochrome P450 enzyme that functions as an obtusifoliol 14α-demethylase in the postsqualene sterol biosynthetic pathway in Arabidopsis thaliana. This enzyme catalyzes the oxidative removal of the 14α-methyl group from sterol precursors, a crucial step in the biosynthesis of membrane sterols such as campesterol and sitosterol . The reaction occurs in three steps, each requiring one molecule of oxygen and two NADPH-derived reducing equivalents. During the first two cycles, which are typical P450-monooxygenations, the 14α-methyl group is converted successively into the 14α-carboxyalcohol and then into the 14α-carboxyaldehyde. In the final step, the 14α-aldehyde group is released as formic acid with the introduction of a Δ14,15 double bond into the sterol core .

What are the technical specifications of recombinant CYP51G1 protein?

Recombinant full-length Arabidopsis thaliana CYP51G1 protein is commercially available as a His-tagged construct comprising the complete 488 amino acid sequence . The protein is typically expressed in E. coli expression systems and provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . The full amino acid sequence includes the conserved domains critical for catalytic function, such as the heme-binding region and substrate recognition sites . For research applications, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and storage with 5-50% glycerol at -20°C/-80°C is recommended to maintain activity through multiple freeze-thaw cycles .

What conserved domains define CYP51G1 as a sterol 14α-demethylase?

CYP51G1 contains specific conserved sequence motifs that constitute the "CYP51 signature" and are critical for its function as a sterol 14α-demethylase. Two key motifs are particularly important: -YxxF/L(i)xxPxFGxxVxF/YD/a- in Substrate Recognition Site 1 (SRS1) and –GQ/hHT/sS- in SRS4 . The SRS1 region forms the upper surface of the substrate binding cavity, and mutations in the conserved Y, F, and G residues in this region result in complete loss of sterol 14α-demethylase activity . Additionally, plant CYP51s including Arabidopsis CYP51G1 contain a phyla-specific F residue in the B' helix that influences substrate preference toward C4-monomethylated sterols, in contrast to animal/fungal CYP51s which contain L in this position and prefer C4-dimethylated substrates .

What phenotypes are observed in cyp51A2/cyp51G1 knockout mutants?

Loss-of-function mutants for CYP51A2/CYP51G1 exhibit a seedling-lethal phenotype with multiple developmental defects . These include:

  • Stunted hypocotyls and short roots

  • Reduced cell elongation

  • Postembryonic seedling lethality

  • Minor defects in early embryogenesis (unlike other sterol mutants such as fk/hydra2 and hydra1)

  • Defects in membrane integrity and hypocotyl elongation

Biochemically, these mutants accumulate obtusifoliol (the substrate of CYP51) and high proportions of 14α-methyl-Δ8-sterols, with corresponding decreases in downstream products like campesterol and sitosterol . Interestingly, the defect in hypocotyl elongation cannot be rescued by exogenous application of brassinolide, although the brassinosteroid-signaling cascade appears to be unaffected in the mutants . The developmental defects can be completely rescued by ectopic expression of functional CYP51A2/CYP51G1, confirming the critical and non-redundant role of this enzyme in Arabidopsis sterol biosynthesis .

How can researchers optimize expression and purification of functional recombinant CYP51G1?

For optimal expression and purification of functional recombinant CYP51G1, researchers should consider the following methodological approach:

  • Expression system selection: While E. coli is commonly used for expressing recombinant CYP51G1 , consider co-expression with chaperones or using eukaryotic expression systems for improved folding of this membrane-associated protein.

  • Construct design: Include the complete 488 amino acid sequence with careful consideration of tagging strategy. N-terminal His-tags are commonly used , but placement should avoid interference with the membrane-binding N-terminal region.

  • Expression conditions:

    • Induce at lower temperatures (16-20°C) to improve proper folding

    • Add δ-aminolevulinic acid (0.5-1 mM) as a heme precursor

    • Include 0.5-1% Triton X-100 or other suitable detergents during lysis to solubilize membrane-associated protein

  • Purification strategy:

    • Use immobilized metal affinity chromatography (IMAC) for initial purification

    • Follow with size exclusion chromatography to improve purity

    • Consider detergent exchange during purification for optimal enzyme activity

  • Storage: As recommended for commercial preparations, store with 5-50% glycerol to prevent activity loss . Aliquot and avoid repeated freeze-thaw cycles.

  • Activity verification: Confirm functional folding by measuring the characteristic Soret peak at ~450 nm in CO-difference spectra, indicating proper heme incorporation.

What are reliable methods for assessing CYP51G1 enzymatic activity in vitro?

Several complementary approaches can be employed to assess CYP51G1 enzymatic activity:

  • Substrate binding assays:

    • Measure type I spectral shifts (increase at ~390 nm, decrease at ~420 nm) upon binding of the natural substrate obtusifoliol

    • Calculate binding constants (Ks) to compare wild-type and mutant proteins

  • Activity assays:

    • Reconstitute enzymatic activity using purified CYP51G1, NADPH-cytochrome P450 reductase, lipids (DLPC or DOPC), and obtusifoliol substrate

    • Monitor NADPH consumption spectrophotometrically at 340 nm

    • Analyze reaction products by GC-MS or LC-MS/MS to confirm 14-demethylated products

  • Inhibition studies:

    • Test azole inhibitors with known efficacy against CYP51 enzymes

    • Determine IC50 values and inhibition constants

    • Use inhibition patterns to analyze active site characteristics

  • Mutagenesis approach:

    • Create point mutations in conserved residues identified in the CYP51 signature regions (especially in SRS1 and SRS4)

    • Assess the effect on activity to validate functional roles of specific amino acids

    • For example, mutations in the conserved Y, F, and G residues in the B' helix result in complete loss of sterol 14α-demethylase activity

How can researchers design effective complementation assays for CYP51G1 functional studies?

Complementation assays provide critical evidence for gene function. For CYP51G1 research, consider these approaches:

  • In planta complementation:

    • Transform heterozygous cyp51A2/+ plants with a functional CYP51G1 construct under native or constitutive promoters

    • Select transformants and identify homozygous cyp51A2 plants rescued by the transgene

    • Quantify the degree of phenotypic rescue in multiple independent lines

  • Cross-species complementation:

    • Express Arabidopsis CYP51G1, with or without mutations, in yeast or bacterial systems lacking endogenous CYP51

    • Assess growth rescue in sterol auxotrophs under selective conditions

    • Compare with known functional CYP51 enzymes from other organisms

  • Domain swap experiments:

    • Create chimeric proteins by exchanging domains between CYP51G1 and the non-functional CYP51A1 pseudogene

    • Identify which regions are essential for complementation

    • This approach revealed that CYP51A1 fails to complement cyp51A2 mutants despite constitutive expression

  • Quantitative assessment:

    • Measure sterol profiles in complemented lines compared to wild-type and mutant backgrounds

    • Develop a scoring system for developmental parameters (hypocotyl length, root growth, etc.)

    • Validate complementation through multiple phenotypic and biochemical criteria

How does Arabidopsis CYP51G1 compare to CYP51 enzymes from other organisms?

CYP51G1 from Arabidopsis shares the fundamental catalytic function of sterol 14α-demethylation with CYP51 enzymes from other organisms, but with important distinctions:

  • Substrate preferences:

    • Plant CYP51s like CYP51G1 preferentially demethylate obtusifoliol and other C4-monomethylated sterols

    • Fungal and animal CYP51s prefer C4-dimethylated substrates like lanosterol

    • These preferences correlate with a phyla-specific residue in the B' helix: F in plants and L in animals/fungi

  • Sequence conservation:

    • Despite divergent evolution, CYP51s maintain sufficient sequence similarity to be classified in a single P450 family

    • Key catalytic motifs are conserved across phyla, including the substrate recognition sites SRS1 and SRS4

    • The heme-binding region consensus sequence (FxxGxRxCxG) is conserved in functional CYP51s including Arabidopsis CYP51G1

  • Inhibitor sensitivity:

    • CYP51G1 shows differential sensitivity to azole inhibitors compared to fungal CYP51s

    • This provides opportunities for developing selective inhibitors for research or agricultural applications

    • The structural basis for these differences involves variations in the binding pocket architecture

  • Evolutionary significance:

    • CYP51 is considered one of the most ancient P450 families, with a proposed evolutionary role

    • The high degree of functional conservation suggests strong selective pressure

    • Arabidopsis CYP51G1 represents the plant-specific evolutionary branch of this ancient enzyme family

What structural features determine substrate specificity in CYP51G1 compared to other CYP51 enzymes?

The substrate specificity of CYP51G1 is determined by several key structural features:

  • B' helix composition:

    • The presence of phenylalanine (F) in the B' helix of plant CYP51s including CYP51G1 correlates with preference for C4-monomethylated sterols

    • In contrast, animal and fungal CYP51s have leucine (L) in this position and prefer C4-dimethylated substrates

    • Experimental evidence from Trypanosoma cruzi CYP51 shows that substituting I for F at this position (I105F) alters substrate preference by more than two orders of magnitude, increasing ability to bind and metabolize C4-monomethyl sterols

  • Substrate Recognition Sites (SRS):

    • SRS1, containing the conserved motif -YxxF/L(i)xxPxFGxxVxF/YD/a-, forms the upper surface of the substrate binding cavity

    • SRS4, with the -GQ/hHT/sS- motif, plays a crucial role in catalysis

    • Together, these regions constitute the "CYP51 signature" that defines functional sterol 14α-demethylases

  • Active site architecture:

    • The spatial arrangement of key catalytic residues positions the substrate for regioselective oxidation at the 14α-methyl group

    • Variations in the substrate access channel accommodate the different sterol side chains found in plant versus animal/fungal sterol precursors

    • These differences provide opportunities for selective inhibitor design

How can researchers leverage CYP51G1 for studying sterol biosynthesis regulation in plants?

CYP51G1 provides an excellent entry point for investigating sterol biosynthesis regulation in plants through several approaches:

  • Promoter analysis:

    • Characterize the CYP51G1 promoter to identify regulatory elements

    • Develop reporter constructs to monitor expression in different tissues and conditions

    • Identify transcription factors that regulate CYP51G1 expression

  • Metabolic engineering:

    • Modulate CYP51G1 expression levels to create plants with altered sterol profiles

    • Investigate the impacts on membrane composition, hormone signaling, and development

    • Use these lines to study sterol homeostasis mechanisms

  • Interaction studies:

    • Identify protein interaction partners of CYP51G1 in the sterol biosynthetic pathway

    • Investigate whether enzymes in this pathway form metabolons for efficient substrate channeling

    • Study potential regulatory interactions with sterol-sensing proteins

  • Stress responses:

    • Monitor CYP51G1 expression and activity under various biotic and abiotic stresses

    • Investigate how plants adjust sterol biosynthesis in response to environmental challenges

    • Develop stress-responsive biosensors based on CYP51G1 promoter elements

What are the most promising strategies for creating modified CYP51G1 enzymes with novel properties?

Protein engineering approaches offer opportunities to create CYP51G1 variants with enhanced or modified properties:

  • Directed evolution:

    • Develop high-throughput screening systems to identify CYP51G1 variants with desired properties

    • Apply error-prone PCR or DNA shuffling to generate diverse libraries

    • Select for variants with improved stability, altered substrate specificity, or enhanced catalytic efficiency

  • Structure-guided mutagenesis:

    • Target the phyla-specific residue in the B' helix to alter substrate preference

    • Modify residues in substrate recognition sites to accommodate novel substrates

    • Engineer the enzyme's temperature stability or solubility through rational design

  • Domain swapping:

    • Create chimeric enzymes incorporating domains from CYP51s of different organisms

    • Swap substrate recognition sites between plant and fungal/animal CYP51s

    • Develop enzymes that can process multiple types of sterol substrates

  • Post-translational modifications:

    • Investigate how phosphorylation or other modifications might regulate CYP51G1 activity

    • Identify modification sites and engineer constitutively active or regulatable variants

    • Study the impact of these modifications on enzyme localization and activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.