Recombinant Arabidopsis thaliana Surfeit locus protein 1-like (At1g48510)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your protocol.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
At1g48510; T1N15.12; Surfeit locus protein 1-like; Surfeit 1-like; Cytochrome c oxidase assembly protein SURF1-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g48510
Target Protein Sequence
MTKLVSKIFKRLISQSQYMSSSTTSNLPAASQTSNLESQLLSSAPPPAKKKRGSALLWYL VGFTTYGLGETYKFLQTQVEHLDSRKQCLEMKPMKLNTTKDLDGLGFRRVVCKGIFDEQR SIYVGPKPRSMSKSSEIGFYVITPLLPIPNEPNSMKSPILVNRGWVPSDWKENSLESLGT GGLVAAAKESRKANKLLSSQQSLLSKFWYKLNNPMIVEDQVSRAMHVEVVGVVRKSETPG IYTLVNYPSSLAWFYLDVPKLALAMGFGEDTMYIESTYTDMDESRTYPVPRDVENLTRSK DIPLDYHLYTVLWHWSSLTCFIKASSILMRRLTKSDPIGVEPILIPISILVFICTKIYSL RNLFCKIDTIGVGCVTKLDTGKVK
Uniprot No.

Target Background

Function
Potentially involved in the biogenesis of the COX complex.
Database Links

KEGG: ath:AT1G48510

STRING: 3702.AT1G48510.1

UniGene: At.38406

Protein Families
SURF1 (TC 3.D.4.8) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Surfeit locus protein 1-like (At1g48510)?

Arabidopsis thaliana Surfeit locus protein 1-like (At1g48510), formally known as AtSURF1b, is one of two SURF1-like genes present in the Arabidopsis genome, the other being At3g17910 (AtSURF1a) . AtSURF1b functions as a cytochrome c oxidase biogenesis protein localized to the mitochondrion . The protein is characterized by two membrane-spanning domains that flank a central loop oriented toward the intermembrane space, a structural arrangement conserved across SURF1 proteins from various organisms .

The SURF1 gene family was first identified in humans, where mutations cause Leigh syndrome, a fatal neurological disease . The name "Surfeit" derives from its presence in a mammalian gene cluster of functionally unrelated genes . In Arabidopsis, AtSURF1b plays crucial roles in mitochondrial function, particularly affecting respiratory chain assembly and hypocotyl growth responses to environmental cues such as light intensity and temperature .

How does AtSURF1b differ from AtSURF1a in Arabidopsis?

While both AtSURF1a and AtSURF1b function as cytochrome c oxidase biogenesis proteins, they exhibit several key differences:

  • Sequence similarity: Human SURF1 shows higher sequence identity and similarity to AtSURF1a (26% identity and 40% similarity) compared to AtSURF1b (19% identity and 34% similarity) .

  • Structural differences: AtSURF1b notably lacks a conserved Trp-Gln pair near the end of the first transmembrane domain that is present in most SURF1 proteins, including AtSURF1a . This conserved motif is thought to be required for heme a binding, at least in bacterial homologs, suggesting potential functional differences between the two Arabidopsis proteins .

  • Expression patterns: AtSURF1a shows more ubiquitous expression throughout plant tissues compared to AtSURF1b, which exhibits more tissue-specific expression patterns . Proteomic analysis has indicated that AtSURF1a is approximately 20-fold more abundant than AtSURF1b, demonstrating significant differences in protein abundance .

  • Functional specialization: AtSURF1b appears to have specific roles in hypocotyl growth responses to various environmental stimuli that may not be shared with AtSURF1a .

What are the molecular characteristics of AtSURF1b?

AtSURF1b is characterized by several distinct molecular features:

CharacteristicDetail
Gene IdentifierAT1G48510
Protein Length384 amino acids
Molecular Weight43,187.60 Da
Isoelectric Point (pI)9.74
GRAVY Score-0.15
Subcellular LocalizationMitochondrion (SUBAcon score: 1.000)
Transmembrane DomainsTwo membrane-spanning helices near N- and C-terminal ends
ConservationHas 339 Blast hits to 337 proteins across 81 species

The protein contains two membrane-spanning helices that are positioned near the N- and C-terminal ends, similar to the arrangement observed in SURF1 proteins from other organisms . The protein sequence contains several functional domains, with the most significant being the Surfeit locus 1 domain (InterPro:IPR002994) . Unlike other SURF1 proteins, AtSURF1b lacks the conserved Trp-Gln pair that is believed to be involved in heme a binding, potentially affecting its functionality in cytochrome c oxidase assembly .

How can recombinant AtSURF1b be expressed and purified?

Recombinant expression and purification of AtSURF1b require specific methodological considerations to obtain functional protein for in vitro studies:

  • Expression system selection: E. coli has been successfully used to express full-length recombinant AtSURF1b (amino acids 1-354) fused with an N-terminal His tag . This approach allows for bacterial expression while maintaining protein functionality.

  • Codon optimization: When expressing plant proteins in bacterial systems, codon optimization may be necessary to enhance expression levels, though specific optimization parameters for AtSURF1b are not detailed in the available literature.

  • Solubilization strategy: As AtSURF1b is a membrane protein with two transmembrane domains, appropriate detergents must be used during extraction and purification to maintain proper folding and function. While specific detergents for AtSURF1b are not mentioned in the search results, mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) are typically used for mitochondrial membrane proteins.

  • Purification approach: Affinity chromatography using the N-terminal His tag allows for selective purification of the recombinant protein . This is typically followed by size exclusion chromatography to enhance purity.

  • Quality control: Proper folding and activity of purified AtSURF1b should be verified through functional assays that assess its ability to complement surf1b mutants or its interaction with components of the cytochrome c oxidase assembly pathway.

Recombinant AtSURF1b is typically supplied as a lyophilized powder after purification, which enhances stability during storage . Researchers should carefully follow reconstitution protocols to maintain protein activity for subsequent experiments.

What techniques are effective for studying AtSURF1b's role in mitochondrial function?

Several complementary techniques have proven effective for investigating AtSURF1b's role in mitochondrial function:

  • Blue Native PAGE (BN-PAGE): This technique has been successfully used to analyze cytochrome c oxidase (COX) levels in surf1b mutants under different light intensity conditions . BN-PAGE preserves protein complexes in their native state, allowing assessment of respiratory chain complex assembly and abundance.

  • In vivo activity assays: Measurement of complex IV (cytochrome c oxidase) activity in isolated mitochondria can reveal functional consequences of AtSURF1b deficiency. This approach identifies not just structural alterations but also functional impacts on respiratory capacity.

  • ROS detection methods: Given that surf1b mutants show increased reactive oxygen species (ROS) production, techniques such as nitro blue tetrazolium (NBT) staining have been employed to detect superoxide levels in plant tissues . This approach helps connect mitochondrial dysfunction with cellular redox status.

  • Genetic complementation: Expression of AtSURF1b in surf1b mutant backgrounds provides a powerful tool to confirm gene function and investigate structure-function relationships. The use of different promoters (native versus constitutive) can provide insights into tissue-specific functions.

  • Transcriptomic analysis: Examining expression changes in mitochondrial dysfunction markers like UGT74E2 in surf1b mutants has revealed connections between respiratory defects and altered cellular signaling .

  • Pharmacological approaches: Using compounds that modify redox status, such as reduced glutathione (GSH), has demonstrated that the phenotypic effects of AtSURF1b deficiency are mediated through redox changes . These approaches reveal the mechanistic basis of mitochondrial retrograde signaling.

How does AtSURF1b influence plant growth and development?

AtSURF1b exerts significant influence on plant growth and development through several interconnected pathways:

  • Hypocotyl elongation responses: surf1b mutants display reduced hypocotyl elongation under various growth-promoting conditions, including low light intensity, increased ambient temperature, and glucose treatment . This indicates that AtSURF1b plays a crucial role in integrating diverse environmental signals into coordinated growth responses.

  • Hormone signaling integration: AtSURF1b deficiency affects both auxin and gibberellin (GA) homeostasis . Specifically, surf1b mutants show reduced expression of the GA biosynthesis gene GA20ox1, and their hypocotyl elongation defects can be rescued by GA treatment, suggesting impaired GA synthesis . These hormonal alterations likely mediate the observed growth phenotypes.

  • Transcription factor regulation: The growth-promoting effects of AtSURF1b operate through the transcription factor PHYTOCHROME INTERACTING FACTOR 4 (PIF4), a key regulator of plant growth responses . The growth promotion effect of AtSURF1b overexpression is completely abolished in a pif4-2 mutant background, demonstrating that PIF4 is required for AtSURF1b's growth effects .

  • Redox signaling: The influence of AtSURF1b on growth appears to be mediated by changes in cellular redox status. Treating surf1b mutants with reduced glutathione (GSH) eliminates the growth differences between wild-type and mutant plants, correlating with decreased superoxide levels detected by NBT staining . This suggests that redox alterations resulting from mitochondrial dysfunction are responsible for the growth effects.

  • Retrograde signaling: AtSURF1b appears to participate in mitochondrial retrograde signaling, where mitochondrial dysfunction leads to altered nuclear gene expression. For example, the UGT74E2 gene, which is typically induced by mitochondrial dysfunction and modifies auxin homeostasis, is significantly upregulated in surf1b mutants .

How do mutations in AtSURF1b affect mitochondrial function and plant physiology?

Mutations in AtSURF1b induce a cascade of effects on mitochondrial function that extend to whole-plant physiology through several interconnected mechanisms:

  • Cytochrome c oxidase (COX) assembly: surf1b mutants show altered COX levels under low light intensity conditions, as revealed by Blue Native PAGE analysis . This demonstrates that AtSURF1b, like SURF1 proteins in other organisms, plays a role in the assembly of complex IV of the respiratory chain.

  • Respiratory chain dysfunction: Impaired COX assembly leads to respiratory chain dysfunction, which has several consequences on cellular metabolism. These include altered energy production capacity and changes in the redox state of respiratory chain components.

  • Increased ROS production: surf1b mutants exhibit increased levels of superoxide, as demonstrated by enhanced nitro blue tetrazolium (NBT) staining . This increased ROS production is likely due to the reaction of reduced respiratory chain components with oxygen when normal electron flow is impaired, a common consequence of respiratory chain dysfunction .

  • Altered retrograde signaling: Mitochondrial dysfunction in surf1b mutants triggers retrograde signaling from mitochondria to the nucleus, resulting in the induction of stress-responsive genes. For example, UGT74E2, a gene induced by mitochondrial dysfunction that modifies auxin homeostasis, is significantly upregulated in surf1b plants .

  • Hormone homeostasis disruption: surf1b mutations lead to changes in both auxin and gibberellin (GA) homeostasis . The reduced expression of GA biosynthesis genes may be a consequence of altered auxin homeostasis, as it has been reported that the expression of GA biosynthesis genes is responsive to auxin .

  • Growth inhibition: The cumulative effect of these alterations is reduced hypocotyl elongation in response to various growth-promoting conditions, including low light intensity, increased ambient temperature, and glucose treatment . This demonstrates how mitochondrial dysfunction can significantly impact whole-plant growth and development.

  • Redox sensitivity: The fact that treatment with reduced glutathione (GSH) eliminates growth differences between wild-type and surf1b mutants suggests that redox changes are the primary mechanism linking mitochondrial dysfunction to altered growth responses .

What is the relationship between AtSURF1b, reactive oxygen species, and hormone signaling?

The relationship between AtSURF1b, reactive oxygen species (ROS), and hormone signaling represents a complex regulatory network that integrates mitochondrial function with plant growth and development:

  • ROS generation: Mutation of AtSURF1b leads to increased production of superoxide, as evidenced by enhanced nitro blue tetrazolium (NBT) staining in surf1b mutant plants compared to wild-type . This increased ROS production is likely a consequence of mitochondrial dysfunction, where inhibition of the respiratory chain leads to the reaction of reduced respiratory components with oxygen .

  • Redox-mediated growth effects: The growth differences between wild-type and surf1b mutant plants disappear when plants are treated with reduced glutathione (GSH), a potent antioxidant . This treatment also correlates with decreased NBT staining in the mutant, confirming that redox changes are responsible for the growth effects of AtSURF1b deficiency .

  • Auxin homeostasis: surf1b mutants show alterations in auxin homeostasis, which may be mediated through the induction of UGT74E2, a UDP-glycosyltransferase that modifies auxin . UGT74E2 is significantly induced in surf1b mutant plants, consistent with previous reports that mitochondrial dysfunction can decrease auxin responses through retrograde signaling .

  • Gibberellin synthesis: AtSURF1b deficiency also affects gibberellin (GA) homeostasis, with reduced expression of the GA biosynthesis gene GA20ox1 in surf1b mutants . The fact that GA treatment can rescue the hypocotyl elongation phenotype of surf1b mutants suggests that GA synthesis is impaired in these plants .

  • Transcription factor regulation: The growth-promoting effects of AtSURF1b are mediated through the transcription factor PIF4, a key regulator of growth responses . The growth promotion effect of AtSURF1b overexpression is completely abolished in a pif4-2 background, indicating that AtSURF1b acts through PIF4 .

  • Hierarchical relationship: The data suggest a hierarchical relationship where mitochondrial dysfunction caused by AtSURF1b deficiency leads to increased ROS production, which alters auxin homeostasis. This, in turn, affects GA synthesis (as GA biosynthesis genes are responsive to auxin) and ultimately impacts growth through the PIF4 transcription factor .

How can researchers design optimal experiments to study AtSURF1b function?

Designing optimal experiments to study AtSURF1b function requires careful consideration of multiple factors to ensure robust and interpretable results:

  • Genetic resources selection:

    • Utilize multiple independent T-DNA insertion lines targeting AtSURF1b to confirm phenotypic consistency

    • Include AtSURF1a mutants for comparative analysis to distinguish unique functions

    • Develop complementation lines expressing AtSURF1b under both native and constitutive promoters

    • Consider creating point mutations that affect specific domains, particularly targeting the unique structural features like the missing Trp-Gln pair

  • Environmental conditions standardization:

    • Control light intensity precisely, as surf1b phenotypes are particularly evident under low light conditions

    • Monitor temperature carefully, as AtSURF1b affects temperature-responsive growth

    • Standardize growth medium composition, particularly with respect to sugars like glucose that interact with the AtSURF1b pathway

    • Consider circadian timing of experiments, as growth responses often show diurnal regulation

  • Mitochondrial function assessment:

    • Combine structural analysis (Blue Native PAGE) with functional measurements (respiratory capacity, ATP production)

    • Monitor multiple ROS species beyond superoxide (H₂O₂, hydroxyl radicals) using appropriate detection methods

    • Assess mitochondrial membrane potential in wild-type versus mutant plants

    • Examine changes in mitochondrial morphology and dynamics

  • Hormone response evaluation:

    • Include hormone treatments (auxins, gibberellins) in experimental design

    • Quantify endogenous hormone levels in different tissues and developmental stages

    • Monitor expression of hormone biosynthesis, transport, and signaling genes

    • Use hormone biosynthesis or signaling mutants to establish epistatic relationships

  • Data interpretation considerations:

    • Distinguish between direct effects of AtSURF1b on cytochrome c oxidase assembly versus indirect consequences

    • Consider developmental timing, as effects may vary across different growth stages

    • Account for potential functional redundancy between AtSURF1a and AtSURF1b

    • Integrate multiple phenotypic readouts (molecular, biochemical, physiological) for comprehensive understanding

By systematically addressing these considerations, researchers can design experiments that provide meaningful insights into AtSURF1b function while minimizing experimental artifacts or misinterpretations of data.

What are common technical challenges when working with AtSURF1b and how can they be overcome?

Researchers working with AtSURF1b encounter several technical challenges that require specific methodological approaches to overcome:

  • Protein expression and purification difficulties:

    • Challenge: As a membrane protein with two transmembrane domains, AtSURF1b can be difficult to express and purify in a functional state.

    • Solution: Expression as a His-tagged fusion protein in E. coli has been successful . Using specialized E. coli strains designed for membrane protein expression and optimizing induction conditions (temperature, inducer concentration) can improve yields. Addition of appropriate detergents during cell lysis and purification is crucial for maintaining protein solubility and native structure.

  • Functional assessment limitations:

    • Challenge: Determining whether recombinant AtSURF1b is functionally active can be difficult without established in vitro assays.

    • Solution: Develop complementation assays where recombinant protein is tested for its ability to rescue surf1b mutant phenotypes. Alternative approaches include measuring interaction with known partners (cytochrome c oxidase subunits) or assessing heme binding capacity despite the absence of the conserved Trp-Gln motif.

  • Phenotypic analysis complications:

    • Challenge: The effects of AtSURF1b mutation can be subtle and highly dependent on environmental conditions.

    • Solution: Carefully control light intensity, temperature, and growth media composition, as surf1b phenotypes are particularly evident under specific conditions such as low light . Quantitative measurements of hypocotyl length should be performed with high replication and under multiple treatment conditions to capture the full range of phenotypic effects.

  • Distinguishing direct and indirect effects:

    • Challenge: As mitochondrial dysfunction affects multiple cellular processes, it can be difficult to distinguish direct effects of AtSURF1b from secondary consequences.

    • Solution: Utilize rapid inducible systems to track early responses before secondary effects emerge. Comprehensive time-course experiments can help establish the sequence of events following AtSURF1b perturbation. Use of redox modulators like GSH can help separate redox-mediated effects from direct consequences of altered COX assembly .

  • Functional redundancy with AtSURF1a:

    • Challenge: Potential functional overlap between AtSURF1a and AtSURF1b can mask phenotypes in single mutants.

    • Solution: Generate and characterize double mutants lacking both genes. Expression of each gene under the other's promoter can test for functional equivalence. Domain-swapping experiments between the two proteins can identify regions responsible for their distinct functions.

What are the key unresolved questions about AtSURF1b function?

Several critical questions about AtSURF1b remain unresolved, presenting opportunities for significant research contributions:

  • Molecular mechanism of COX assembly: While AtSURF1b is implicated in cytochrome c oxidase biogenesis, the precise molecular mechanism by which it facilitates this process remains unclear . Specifically, how does AtSURF1b function despite lacking the conserved Trp-Gln pair that is thought to be required for heme a binding in other SURF1 proteins?

  • Functional divergence from AtSURF1a: AtSURF1b appears to have specific roles distinct from AtSURF1a, but the evolutionary forces driving this functional specialization and its biological significance are not fully understood . Why has Arabidopsis maintained two SURF1 homologs with potentially different functions?

  • Tissue-specific roles: The expression patterns of AtSURF1b suggest potential tissue-specific functions, but these have not been comprehensively characterized . How does AtSURF1b function in different tissues and developmental stages?

  • Signal integration mechanism: How AtSURF1b integrates diverse environmental signals (light, temperature, nutrient status) into coordinated growth responses remains to be elucidated . What are the molecular components that link mitochondrial function to these diverse signaling pathways?

  • ROS signaling specificity: While increased ROS production is observed in surf1b mutants, the specific ROS species involved and their subcellular localization patterns that lead to altered hormone homeostasis remain to be clarified . How is ROS signaling specificity achieved?

  • Conservation across species: The degree to which AtSURF1b function is conserved across plant species and how it may have adapted to different ecological niches presents an interesting evolutionary question. Do SURF1 proteins play similar roles in growth regulation across the plant kingdom?

  • Potential therapeutic applications: Given that human SURF1 mutations cause Leigh syndrome, understanding how plant SURF1 proteins function could potentially provide insights relevant to human disease mechanisms . Could plant models provide novel insights into mitochondrial disease mechanisms?

How might AtSURF1b research contribute to broader understanding of plant adaptation mechanisms?

Research on AtSURF1b has significant potential to advance our understanding of plant adaptation mechanisms through several key avenues:

  • Integration of environmental signals: AtSURF1b plays a role in plant responses to multiple environmental factors, including light intensity, temperature, and nutrient status . Understanding how this mitochondrial protein contributes to these diverse responses could reveal fundamental mechanisms by which plants integrate environmental information to optimize growth and development.

  • Mitochondrial retrograde signaling: The study of how AtSURF1b deficiency triggers changes in nuclear gene expression represents an excellent model for investigating mitochondrial retrograde signaling . This communication pathway from mitochondria to the nucleus is critical for cellular homeostasis and adaptation to environmental changes.

  • Redox-hormone crosstalk: The connection between AtSURF1b, ROS production, and hormone signaling exemplifies the complex regulatory networks that coordinate plant growth . Further exploration of these interactions could illuminate how plants maintain growth plasticity while ensuring cellular redox balance.

  • Evolutionary adaptation of energy metabolism: Comparative studies of SURF1 proteins across plant species adapted to different ecological niches could reveal how energy metabolism has been optimized for specific environmental conditions. This could provide insights into the evolution of plant adaptation strategies.

  • Developmental energy allocation: AtSURF1b's influence on growth responses suggests a role in regulating energy allocation during development . Understanding this process could shed light on how plants make "decisions" about resource allocation between growth, defense, and reproduction under changing conditions.

  • Stress tolerance mechanisms: The connection between mitochondrial function, ROS signaling, and hormone homeostasis revealed by AtSURF1b research has implications for understanding plant stress tolerance . These pathways are critical for plant adaptation to adverse conditions, including those associated with climate change.

  • Crop improvement applications: Knowledge gained from AtSURF1b research could potentially be applied to crop improvement strategies, particularly those focused on enhancing growth under suboptimal conditions or improving energy use efficiency in agriculturally important species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.