Recombinant Arabidopsis thaliana Surfeit locus protein 1 (SURF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SURF1; EMB3121; At3g17910; MEB5.13; Surfeit locus protein 1; Surfeit 1; Cytochrome c oxidase assembly protein SURF1; Protein EMBRYO DEFECTIVE 3121; Surfeit locus 1 cytochrome c oxidase biogenesis protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SURF1
Target Protein Sequence
MATSLSKILTRSNTKRYWCSTTTSISASPSLPKQFWSRHFSAVADSSSSSSAALGSQSSS SAPPQENKRGSKWSQLLLFLPGAITFGLGSWQIVRREEKFKTLEYQQQRLNMEPIKLNID HPLDKNLNALEFRRVSCKGVFDEQRSIYLGPRSRSISGITENGFFVITPLMPIPGDLDSM QSPILVNRGWVPRSWREKSQESAEAEFIANQSTKAKSPSNEPKSWWKFWSKTPVITKEHI SAVKPVEVVGVIRGGENPSIFVPSNDPSTGQWFYVDVPAMARAVGLPENTIYVEDVHEHV DRSRPYPVPKDINTLIRSKVMPQDHLNYSITWYSLSAAVTFMAYKRLKAKPVRR
Uniprot No.

Target Background

Function

Likely involved in the biogenesis of the COX complex.

Database Links

KEGG: ath:AT3G17910

STRING: 3702.AT3G17910.1

UniGene: At.8040

Protein Families
SURF1 (TC 3.D.4.8) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are SURF1 proteins in Arabidopsis thaliana and how many genes encode them?

Arabidopsis thaliana possesses two genes that encode SURF1 proteins (AtSURF1a and AtSURF1b), resulting from a duplication event that occurred specifically in the Brassicaceae family. Both genes encode mitochondrial proteins that are involved in the assembly of cytochrome c oxidase (COX), a critical component of the mitochondrial respiratory chain. The presence of two SURF1 genes is a distinguishing feature of Arabidopsis compared to many other organisms that contain only a single SURF1 gene .

What is the subcellular localization of AtSURF1 proteins?

AtSURF1 proteins are localized in the mitochondria of Arabidopsis thaliana cells. This localization is consistent with their function in the assembly of cytochrome c oxidase (COX), which is a component of the electron transport chain located in the inner mitochondrial membrane. Experimental verification of this localization has been achieved through techniques such as fluorescent protein tagging and subcellular fractionation studies .

What are the phenotypic effects of mutations in AtSURF1 genes?

Mutations in the two AtSURF1 genes produce distinctly different phenotypic outcomes:

  • AtSURF1a mutation: Causes embryonic lethality, indicating that this gene plays an essential role in early plant development that cannot be compensated by AtSURF1b .

  • AtSURF1b mutation: Results in specific growth defects, particularly in hypocotyl elongation under growth-stimulating conditions such as low light intensity, increased ambient temperature, and glucose exposure. Unlike AtSURF1a, these mutations are not lethal .

This differential impact suggests that while both proteins share similar functions in mitochondrial respiration, they have distinct roles in plant development and stress responses.

How do AtSURF1 proteins affect cytochrome c oxidase (COX) activity?

AtSURF1 proteins play a crucial role in the assembly and maintenance of cytochrome c oxidase (COX) complexes in the mitochondrial respiratory chain. Mutations in AtSURF1b result in measurably lower COX levels in plant tissues. Specifically, AtSURF1b-deficient plants display:

  • Reduced COX enzyme activity

  • Compensatory increases in alternative oxidase levels

  • Elevated superoxide levels

  • Increased expression of genes responsive to mitochondrial dysfunction

What is the relationship between AtSURF1 function and hormone signaling?

AtSURF1b mutations create significant disruptions in plant hormone homeostasis and signaling pathways:

HormoneEffect of AtSURF1b MutationDetection MethodRestoration Method
AuxinReduced signalingDecreased DR5:GUS reporter expressionTreatment with indole-3-acetic acid or increased YUC8 expression
GibberellinAltered signalingIncreased GFP-RGA reporter levelsTreatment with gibberellin A3

The relationship appears to be mediated through redox signaling, as treatment with reduced glutathione can reverse the decreased hypocotyl growth and DR5:GUS expression in AtSURF1b mutants. This suggests that reactive oxygen species generated as a result of mitochondrial dysfunction act as intermediary signals affecting hormone responses .

What are the recommended approaches for generating recombinant AtSURF1 proteins?

For producing recombinant AtSURF1 proteins, the following methodological approach is recommended:

  • Gene cloning and optimization: The AtSURF1 coding sequence should be amplified from Arabidopsis cDNA and optimized for the expression system of choice. For bacterial expression, codon optimization may improve yield.

  • Expression vector selection: For functional studies, vectors containing appropriate plant promoters (such as CaMV 35S for constitutive expression) are recommended. For protein purification, bacterial expression systems using pET vectors with histidine tags facilitate purification.

  • Expression systems:

    • For biochemical characterization: E. coli BL21(DE3) strain

    • For functional complementation studies: AtSURF1-deficient Arabidopsis lines

  • Purification strategy: Affinity chromatography using nickel columns for His-tagged proteins, followed by size exclusion chromatography to ensure protein homogeneity.

Note that when expressing mitochondrial proteins, it is often necessary to exclude the mitochondrial targeting sequence to improve solubility and stability of the recombinant protein .

How can researchers effectively analyze the impact of AtSURF1 mutations on mitochondrial function?

To comprehensively analyze mitochondrial function in AtSURF1 mutants, a multi-parameter approach is recommended:

  • Respiratory complex activity measurements:

    • Spectrophotometric assays for cytochrome c oxidase (Complex IV) activity

    • Blue native PAGE to assess assembly of respiratory complexes

    • Oxygen consumption measurements using Clark-type electrodes

  • Reactive oxygen species (ROS) detection:

    • Fluorescent probes (e.g., DCF-DA for hydrogen peroxide, MitoSOX for mitochondrial superoxide)

    • NBT staining for superoxide detection in tissues

  • Mitochondrial membrane potential analysis:

    • JC-1 or TMRM dyes for fluorescence microscopy or flow cytometry

  • Gene expression analysis:

    • qRT-PCR for nuclear genes responsive to mitochondrial dysfunction

    • Analysis of alternative oxidase expression as a marker of mitochondrial stress

  • Mitochondrial morphology:

    • Transmission electron microscopy

    • Confocal microscopy with mitochondria-targeted fluorescent proteins

These methods collectively provide a comprehensive picture of how AtSURF1 mutations affect various aspects of mitochondrial function .

How do the functions of AtSURF1a and AtSURF1b differ, and what explains their non-redundancy?

Despite their shared ancestry and similar biochemical functions, AtSURF1a and AtSURF1b exhibit functional specialization that prevents complete redundancy:

  • Developmental timing: AtSURF1a appears critical during embryogenesis, while AtSURF1b functions predominantly in post-germination growth responses. This temporal separation may reflect divergent regulation of gene expression during development.

  • Tissue specificity: Though both are mitochondrial proteins, they may have evolved differential expression patterns across plant tissues, contributing to their non-redundant roles.

  • Protein-protein interactions: The two homologs might interact with different sets of assembly factors or respiratory chain components, creating functional specificity.

  • Stress response roles: AtSURF1b appears particularly important during specific environmental challenges (low light, temperature shifts), suggesting specialization in stress-responsive pathways.

Research approaches to address this question should include comprehensive expression profiling across tissues and developmental stages, protein interaction studies, and detailed phenotypic analysis of tissue-specific complementation experiments .

What is the relationship between mitochondrial redox status and hormone signaling in AtSURF1 mutants?

The connection between mitochondrial function and hormone signaling in AtSURF1b mutants represents a complex regulatory network:

  • Redox-hormone signaling pathway: Mitochondrial dysfunction in AtSURF1b mutants leads to increased reactive oxygen species (ROS), which appears to negatively impact auxin signaling (reduced DR5:GUS expression) and alter gibberellin responses (increased GFP-RGA levels).

  • Transcription factor involvement: The reduced abundance of the transcription factor PIF4 in AtSURF1b-deficient plants serves as a critical link, as PIF4 regulates both auxin biosynthesis gene YUC8 and responses to environmental signals like temperature and light.

  • Restoration mechanisms: The fact that both direct hormone application (IAA, GA3) and redox manipulation (reduced glutathione) can restore normal growth suggests parallel pathways that converge on growth regulation.

A proposed model for this interaction includes:

  • AtSURF1b mutation → decreased COX activity → increased ROS production

  • Altered redox status → decreased PIF4 activity

  • Reduced PIF4 → decreased auxin biosynthesis → reduced growth responses

  • Intervention with either hormones or redox modulators can bypass specific steps in this pathway

This model explains why growth defects in AtSURF1b mutants are particularly evident under conditions that typically promote growth through these specific hormone pathways .

How does the function of AtSURF1 compare to SURF1 proteins in other organisms, particularly in relation to human disease?

AtSURF1 proteins share functional similarities with SURF1 proteins in other organisms, but with important distinctions:

  • Conservation of primary function: Both plant AtSURF1 and human SURF1 proteins affect cytochrome c oxidase (COX) assembly and activity. Mutations in both cases lead to reduced COX levels and mitochondrial dysfunction .

  • Disease manifestation differences:

    • In humans, SURF1 mutations cause Leigh syndrome, a severe neurodegenerative disorder

    • In Arabidopsis, AtSURF1a mutation causes embryonic lethality, while AtSURF1b mutation affects growth but is not lethal

    • Mouse SURF1 knockout models show surprising phenotypes including extended lifespan

  • Therapeutic approaches: Research in animal models has demonstrated that adeno-associated viral vector serotype 9 (AAV9)/human SURF1 gene replacement therapy can partially rescue complex IV activity in multiple tissues and mitigate blood lactic acidosis in SURF1 knockout mice .

  • Evolutionary considerations: The duplication of SURF1 in Brassicaceae suggests potential evolutionary advantages in plants that may not be present in animals, possibly related to metabolic flexibility under varying environmental conditions.

This comparative understanding highlights both the conserved role of SURF1 proteins in mitochondrial function across eukaryotes and the lineage-specific adaptations that have evolved in different taxonomic groups .

How can AtSURF1 research contribute to understanding mitochondrial-nuclear communication?

AtSURF1 mutants provide an excellent model system for studying retrograde signaling (mitochondria-to-nucleus communication) for several reasons:

  • Specific mitochondrial defect: AtSURF1b mutations create a defined disruption in COX assembly that triggers broader cellular responses, allowing researchers to trace specific signaling pathways.

  • Transcriptional responses: AtSURF1b-deficient plants show increased expression of nuclear genes responding to mitochondrial dysfunction, providing molecular markers for retrograde signaling.

  • Hormone integration: The clear connection between mitochondrial dysfunction and hormone responses in these mutants offers insights into how energy metabolism influences growth and development.

Research approaches to leverage AtSURF1 mutants for understanding mitochondrial-nuclear communication include:

  • Transcriptome analysis comparing wild-type and AtSURF1b mutants under various stress conditions

  • Genetic screens for suppressors or enhancers of AtSURF1b phenotypes

  • Identification of transcription factors that respond to the altered redox state in mutants

  • Metabolomic profiling to identify signaling molecules that may transmit information from mitochondria to the nucleus

These approaches could reveal fundamental mechanisms by which plant cells coordinate mitochondrial function with nuclear gene expression to optimize growth and stress responses .

What are the most promising research directions for understanding the connection between mitochondrial function and plant hormone responses?

The relationship between mitochondrial function and hormone signaling revealed by AtSURF1 research suggests several high-priority research directions:

  • Identification of redox-sensitive components in hormone signaling pathways: Determining precisely how ROS or altered redox status affects PIF4 activity and stability could reveal critical regulatory mechanisms.

  • Exploration of metabolic checkpoints in hormone biosynthesis: Investigating whether mitochondrial dysfunction affects hormone biosynthetic pathways through energetic constraints or specific signaling molecules.

  • Comparative analysis across environmental conditions: Systematically analyzing how different environmental factors (light, temperature, sugars) interact with mitochondrial function to modulate hormone responses.

  • Development of biosensors: Creating in vivo sensors to simultaneously monitor mitochondrial function, ROS levels, and hormone signaling dynamics in real-time.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and metabolomic data to build predictive models of how mitochondrial status influences hormone networks.

These research directions could significantly advance our understanding of how plants integrate metabolic status with growth control mechanisms, with potential applications in improving crop responses to environmental stresses .

What strategies can address difficulties in phenotyping subtle growth differences in AtSURF1 mutants?

Detecting and accurately measuring the phenotypic effects of AtSURF1b mutations can be challenging, particularly because these effects are often condition-dependent. The following strategies can improve phenotyping accuracy:

  • Controlled growth conditions:

    • Use precise light controllers to maintain specific photon flux densities, especially for low light experiments (approximately 125 μmol m⁻²s⁻¹)

    • Implement temperature controls with ±0.1°C precision for experiments at elevated temperatures

    • Standardize media composition, particularly glucose concentrations

  • Automated phenotyping approaches:

    • High-throughput imaging systems with time-lapse capabilities

    • Software for objective quantification of hypocotyl length, growth rates, and morphological parameters

    • Infrared imaging to detect subtle metabolic differences

  • Experimental design considerations:

    • Include multiple biological and technical replicates (minimum n=30 for growth measurements)

    • Randomize placement of genotypes within growth chambers to control for position effects

    • Use heterozygous siblings as controls when possible to minimize background effects

  • Stress-induced phenotyping:

    • Apply specific conditions known to exacerbate AtSURF1b phenotypes (low light, increased temperature, glucose supplementation)

    • Implement kinetic measurements rather than endpoint analyses to capture transient responses

These approaches can significantly improve the detection and characterization of subtle phenotypic differences in AtSURF1 mutants .

How can researchers address challenges in measuring mitochondrial function in plant systems?

Measuring mitochondrial function in plants presents unique challenges compared to animal systems. The following methodological approaches can help overcome these difficulties:

  • Isolation of functional mitochondria:

    • Optimize tissue disruption methods (gentle grinding in osmotically stabilized buffers)

    • Use Percoll gradient purification to separate mitochondria from chloroplasts and peroxisomes

    • Verify mitochondrial integrity using cytochrome c reduction assays

  • Respiratory measurements in intact tissues:

    • Dark-adapt samples to minimize chloroplast interference

    • Use tissue-specific oxygen microsensors for in situ measurements

    • Apply specific inhibitors to distinguish between cytochrome and alternative respiratory pathways

  • Managing plant-specific interferents:

    • Account for chlorophyll autofluorescence when using fluorescent probes

    • Consider interference from plant phenolic compounds in spectrophotometric assays

    • Use appropriate controls for plant-specific alternative oxidase activity

  • Data normalization approaches:

    • Normalize to mitochondrial protein rather than total cellular protein

    • Consider using mitochondrial DNA copy number as a normalization factor

    • When appropriate, normalize to specific mitochondrial marker proteins rather than bulk protein

By implementing these specialized techniques, researchers can obtain more reliable measurements of mitochondrial function in AtSURF1 mutants and other plant systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.