Recombinant Arabidopsis thaliana Translocase of chloroplast 34, chloroplastic (TOC34)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
TOC34; OEP34; PPI3; At5g05000; MUG13.14; Translocase of chloroplast 34, chloroplastic; AtToc34; 34 kDa chloroplast outer envelope protein; GTP-binding protein OEP34; Plastid protein import 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TOC34
Target Protein Sequence
MAALQTLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIG EKAAAVSTFQSEGLRPTLVSRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTID VLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALVLTHAQFSPPDGLNYNHFVSKR SNALLKVIQTGAQLKKQDLQGFSIPVILVENSGRCHKNESDEKILPCGTSWIPNLFNKIT EISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKPA WELRDSGLASRRS
Uniprot No.

Target Background

Function
This GTPase facilitates the import of protein precursors into chloroplasts. It appears to recognize chloroplast-targeted precursor proteins and regulate their delivery to the translocation channel via GTP hydrolysis. It likely specializes in the import of nuclear-encoded, non-photosynthetic preproteins from the cytoplasm into the chloroplast.
Gene References Into Functions
  1. Embryo development in atToc33/34 mutants exhibited slowed progression and arrested at the globular stage transition. PMID: 16435266
Database Links

KEGG: ath:AT5G05000

STRING: 3702.AT5G05000.1

UniGene: At.67852

Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, TOC34 subfamily
Subcellular Location
Plastid, chloroplast outer membrane; Single-pass membrane protein. Note=May contain beta barrel transmembrane regions.
Tissue Specificity
Mostly expressed in roots and flowers, and, to a lower extent, in seedlings, stems, and leaves.

Q&A

What is the structure and function of TOC34 in chloroplasts?

TOC34 is a chloroplastic outer envelope protein containing a single transmembrane domain at its C-terminus and a cytosolic GTP-binding domain . Functionally, TOC34 serves as a receptor component of the chloroplast protein import machinery, specifically recognizing and binding to transit peptides of chloroplast-targeted preproteins .

The protein can be structurally divided into:

  • A cytosolic nucleotide-binding domain that interacts with GTP/GDP

  • A C-terminal transmembrane domain that anchors the protein to the outer envelope membrane

  • Regions that are subject to phosphorylation, which regulates its activity

For experimental studies, researchers often express a truncated form (Toc34ΔTM) lacking the transmembrane domain to maintain solubility and avoid denaturation during purification processes .

How do researchers express and purify recombinant TOC34 for experimental studies?

The expression and purification of recombinant TOC34 typically follows these methodological steps:

  • Generate a truncated construct: Remove the C-terminal transmembrane domain (typically expressed as Toc34ΔTM) to ensure solubility when expressed in bacterial systems .

  • Add a purification tag: Incorporate a 6-histidine tag (6His) for affinity purification .

  • Express in bacteria: Transform the construct into an E. coli expression system and induce protein expression with isopropyl-β-d-thiogalactopyranoside (IPTG) .

  • Purify via affinity chromatography: Use metal affinity matrices (such as Talon-metal matrix) for purification of the His-tagged protein .

  • Verify identity and functionality: Confirm the identity of the purified protein using immunoblotting with specific antibodies and assess functionality through GTP-binding assays .

The purified recombinant protein should retain functional characteristics of the native protein, particularly its ability to specifically bind GTP in a Mg²⁺-dependent manner, with binding that can be competed by GTP or GDP but not by ATP .

What techniques are used to verify the functional integrity of recombinant TOC34?

To ensure that recombinant TOC34 maintains its native functional properties, researchers should implement the following methodological approaches:

  • Nucleotide binding assays: Test the ability of purified Toc34ΔTM to bind radioactive-labeled GTP, which should be enhanced in the presence of Mg²⁺ .

  • Competition studies: Verify specificity by demonstrating that GTP binding can be competed by unlabeled GTP or GDP but not by ATP .

  • Phosphorylation assays: Assess the protein's ability to be phosphorylated by either outer envelope membrane kinases or by kinase-enriched fractions from plant tissues such as wheat germ .

  • Preprotein interaction studies: Measure binding affinity to chloroplast-targeted preproteins (such as preSSU) using pull-down assays, with binding expected to be enhanced in the presence of GTP .

  • Limited proteolysis: Use enzymes like endoproteinase Glu-C to generate peptide patterns that can confirm proper folding and accessibility of functional domains .

Functional recombinant TOC34 should display characteristics similar to the wild-type protein in terms of nucleotide specificity, regulatory mechanisms, and interactions with transit peptides.

How is TOC34 activity regulated by GTP/GDP binding and phosphorylation?

TOC34 activity is regulated through a complex interplay of GTP/GDP binding and phosphorylation states, creating a sophisticated control mechanism for preprotein recognition and import:

  • GTP binding regulation:

    • GTP binding significantly increases TOC34's affinity for preproteins (Kd ≈ 0.1 nM in the presence of 1 mM GTP)

    • In the GTP-bound state, TOC34 forms high-affinity interactions with phosphorylated transit peptides

    • GDP binding induces the release of bound preproteins, suggesting a GTP/GDP cycle regulates substrate binding and release

  • Phosphorylation regulation:

    • TOC34 can be phosphorylated by kinases present in the chloroplast outer envelope membrane

    • Phosphorylation of TOC34 drastically reduces both its ability to bind GTP and to recognize preproteins

    • Phosphorylated TOC34 shows at least 4-fold decreased binding to preproteins compared to non-phosphorylated TOC34

  • Dephosphorylation:

    • Dephosphorylation of TOC34 is mediated by a phosphatase in an ATP-dependent manner

    • This dephosphorylation restores TOC34's ability to bind GTP and interact with preproteins

The experimental assessment of these regulatory mechanisms typically involves:

  • Comparing preprotein binding between phosphorylated and non-phosphorylated TOC34

  • Measuring GTP binding under various phosphorylation conditions

  • Assessing preprotein release upon GDP addition

  • Using phosphatase inhibitors to prevent dephosphorylation

This regulatory cycle ensures that TOC34 can switch between active and inactive states, providing a controlled mechanism for preprotein import into chloroplasts .

What experimental approaches can differentiate between different TOC34 homologs?

Distinguishing between different TOC34 homologs requires sophisticated experimental designs that can identify functional and structural differences:

  • Immunological differentiation:

    • Generate homolog-specific antibodies targeting unique epitopes in each TOC34 variant

    • Use these antibodies in immunoblotting, immunoprecipitation, or antibody inhibition experiments to distinguish between homologs

  • Competition experiments:

    • Design assays where isolated homologs compete for binding to specific preproteins

    • Measure differential binding affinities to identify homolog-specific preferences

  • Genetic complementation studies:

    • Express different TOC34 homologs in knockout/mutant lines (e.g., expressing atToc132GM in ppi2 mutant Arabidopsis plants)

    • Assess the degree of functional rescue by measuring parameters such as:

      • Chlorophyll content (quantified as % of wild-type levels)

      • Plant viability and growth rates

      • Accumulation of specific plastid proteins

  • Domain swap experiments:

    • Create chimeric proteins by exchanging domains between different TOC34 homologs

    • Test the functionality and specificity of these chimeric proteins to determine which domains confer specific recognition properties

  • Receptor selectivity assays:

    • Express the GTP-binding domain (G-domain) and membrane anchor (M-domain) of different TOC34 homologs

    • Assess their ability to recognize different classes of preproteins (e.g., photosynthetic vs. non-photosynthetic)

These approaches have demonstrated that even closely related TOC34 homologs (like TOC33 and TOC34 in Arabidopsis) can have distinct but partially overlapping functions in recognizing different subsets of chloroplast-targeted proteins .

How can researchers design experiments to study the specificity of TOC34 for different precursor proteins?

To investigate TOC34's specificity for different precursor proteins, researchers should employ a systematic experimental approach:

  • Preprotein binding assays:

    • Use purified recombinant TOC34 (typically Toc34ΔTM) immobilized on affinity matrices

    • Incubate with different radiolabeled preproteins under various nucleotide conditions (±GTP, ±GDP)

    • Quantify binding through scintillation counting or phosphorimaging

    • Calculate binding affinities (Kd values) for different preprotein-TOC34 combinations

  • Competition studies:

    • Perform binding assays with labeled preprotein in the presence of increasing concentrations of unlabeled competing preproteins

    • Test both phosphorylated and non-phosphorylated forms of transit peptides

    • Analyze displacement curves to determine relative affinities

  • Transit peptide domain mapping:

    • Generate truncated or mutated versions of transit peptides

    • Test their binding to TOC34 to identify specific recognition motifs

    • Use alanine-scanning mutagenesis to identify critical residues for TOC34 interaction

  • Cross-linking experiments:

    • Use bifunctional cross-linking agents to capture transient interactions between TOC34 and transit peptides

    • Analyze cross-linked products by mass spectrometry to identify interaction interfaces

  • Import competition assays:

    • Use isolated chloroplasts to perform import assays with mixed preprotein populations

    • Add specific antibodies against different TOC34 homologs to selectively inhibit import pathways

    • Quantify differential effects on various preprotein classes

These approaches have revealed that TOC34 preferentially binds phosphorylated transit peptides with significantly higher affinity than non-phosphorylated forms, and that different TOC34 homologs may preferentially interact with distinct groups of precursor proteins .

What are the methodological challenges in studying TOC34 phosphorylation in vivo?

Investigating TOC34 phosphorylation in vivo presents several methodological challenges that researchers must address:

  • Identification of phosphorylation sites:

    • TOC34 can be phosphorylated by multiple kinases (both ATP and GTP-dependent)

    • Limited proteolysis with endoproteinase Glu-C can generate labeled peptide patterns to help identify phosphorylation sites

    • Mass spectrometry approaches need to be optimized for membrane proteins to precisely map phosphorylation sites

  • Temporal dynamics of phosphorylation:

    • Phosphorylation states may change rapidly during import processes

    • Time-resolved studies require synchronized systems and rapid isolation techniques

    • Development of phospho-specific antibodies for monitoring phosphorylation status in real-time

  • Identification of regulatory kinases and phosphatases:

    • Multiple kinases can phosphorylate TOC34 (envelope-bound kinases and cytosolic kinases)

    • Developing specific inhibitors or using genetic approaches to identify the relevant kinases in vivo

    • Determining how ATP-dependent phosphatases are regulated during the import cycle

  • Distinguishing between homologs:

    • Different TOC34 homologs may have distinct phosphorylation patterns

    • Developing assays that can differentiate between closely related proteins

    • Accounting for potential cross-regulation between different TOC complexes

  • Functional consequences in complex environments:

    • Correlating phosphorylation states with import efficiency in intact cells

    • Separating the effects of TOC34 phosphorylation from other regulatory mechanisms

    • Accounting for developmental and tissue-specific regulation of phosphorylation

Addressing these challenges requires combining in vitro biochemical approaches with in vivo studies using techniques like phospho-proteomics, genetic manipulation of kinases/phosphatases, and development of phosphorylation state-specific probes.

How should researchers design experiments to investigate TOC34-mediated preprotein import pathways?

Designing robust experiments to study TOC34-mediated import pathways requires careful consideration of multiple factors:

  • Experimental system selection:

    • In vitro: Isolated chloroplasts for controlled import assays

    • Ex vivo: Protoplasts for transient expression studies

    • In vivo: Stable transgenic plants for physiological relevance

    • Heterologous systems: Bacterial or yeast expression for specific interaction studies

  • Sample size and statistical power:

    • Determine appropriate biological and technical replicates (minimum n=3 for each)3

    • Calculate sample sizes needed to detect biologically significant differences

    • Implement appropriate statistical tests based on data distribution and experimental design3

  • Control design:

    • Include positive controls (known TOC34 substrates like photosynthetic proteins)

    • Use negative controls (non-chloroplast proteins)

    • Incorporate competition controls with unlabeled substrates

    • Test homolog specificity with mutant/knockout lines

  • Variables to consider:

    • Nucleotide requirements (GTP, GDP, non-hydrolyzable GTP analogs)

    • Phosphorylation status of both TOC34 and transit peptides

    • Developmental stage of plant material

    • Environmental conditions (light/dark, stress)

  • Readout selection:

    • Direct measurement of protein-protein interactions (pull-downs, SPR, ITC)

    • Functional import assays (radiolabeled precursors, fluorescent reporters)

    • Phenotypic assessment of mutants (chlorophyll content, growth parameters)

    • Proteomics to identify differential import of protein classes

A well-designed experimental approach would involve multiple complementary techniques. For example, combining in vitro binding studies with in vivo genetic complementation experiments and quantitative phenotypic analyses provides a more comprehensive understanding than any single approach alone .

How can researchers reconcile contradictory data about TOC34 substrate specificity?

When faced with contradictory data regarding TOC34 substrate specificity, researchers should implement a systematic approach to resolve discrepancies:

  • Critical evaluation of experimental conditions:

    • Compare nucleotide concentrations and types used across studies

    • Assess differences in phosphorylation status of TOC34 and preproteins

    • Evaluate protein preparation methods (native vs. recombinant, full-length vs. truncated)

    • Consider differences in assay conditions (temperature, pH, salt concentration)

  • Reconciliation through complementary techniques:

    • Use multiple binding assays (pull-down, SPR, ITC) to validate interactions

    • Combine in vitro binding with in vivo import studies

    • Implement crosslinking approaches with different reagents to capture transient interactions

    • Employ competition assays with defined substrate mixtures

  • Homolog-specific analyses:

    • Test substrate specificity with individual TOC34 homologs

    • Use chimeric constructs to identify domains responsible for specificity differences

    • Implement genetic complementation to assess functional redundancy

  • Consideration of complex formation:

    • Examine how association with other TOC components affects specificity

    • Test different combinations of TOC34 and TOC159 family members

    • Assess the influence of membrane environment on receptor behavior

  • Meta-analysis framework:

    • Systematically compare methodologies across contradictory studies

    • Weight evidence based on experimental rigor and reproducibility

    • Develop unified models that accommodate apparently contradictory observations

A concrete example of reconciling contradictory data comes from studies of Arabidopsis TOC receptors, where initial work suggested strict specificity, but subsequent studies demonstrated that atToc132GM could partially rescue the ppi2 mutant phenotype, indicating overlapping functions despite preferential substrate interactions .

What are the optimal methods for quantitatively assessing TOC34 binding affinity to transit peptides?

For precise quantification of TOC34-transit peptide interactions, researchers should consider these methodological approaches:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant TOC34 on sensor chips

    • Flow different concentrations of transit peptides over the surface

    • Measure real-time binding and dissociation

    • Calculate association (kon) and dissociation (koff) rate constants

    • Determine equilibrium dissociation constants (Kd)

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Determine stoichiometry, binding affinity, and enthalpy changes

    • No labeling or immobilization required

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG)

  • Microscale Thermophoresis (MST):

    • Label either TOC34 or transit peptides with fluorescent dyes

    • Measure changes in thermophoretic mobility upon binding

    • Requires minimal sample amounts

    • Works well with membrane proteins in detergent solutions

  • Pull-down assays with quantitative analysis:

    • Use radiolabeled ([32P]) transit peptides for high sensitivity

    • Implement increasing concentrations of substrate to generate binding curves

    • Analyze data through Scatchard plots or non-linear regression

    • Calculate apparent Kd values under different nucleotide conditions

Researchers have determined that TOC34 binds phosphorylated preSSU with very high affinity (Kd = 0.1 nM) in the presence of 1 mM GTP, while showing lower affinity for non-phosphorylated forms . These measurements should be performed under varying conditions to assess how factors such as:

  • Nucleotide type and concentration (GTP vs. GDP)

  • Phosphorylation status of both receptor and substrate

  • Divalent cation concentration (particularly Mg²⁺)

  • Temperature and pH

affect binding parameters, providing insight into the physiological regulation of these interactions.

What protein engineering approaches can improve recombinant TOC34 expression and stability?

To enhance recombinant TOC34 expression and stability for research applications, consider these protein engineering strategies:

  • Domain-based optimization:

    • Express the cytosolic nucleotide-binding domain without the transmembrane region (Toc34ΔTM)

    • Incorporate a C-terminal 6-histidine tag for purification while preserving N-terminal function

    • Test various truncation points to maximize stability while maintaining function

  • Expression system selection:

    • Bacterial systems: Optimize codon usage for E. coli

    • Eukaryotic systems: Consider yeast or insect cells for proper folding

    • Cell-free systems: For rapid production and avoiding toxicity issues

  • Solubility enhancement strategies:

    • Fusion partners: MBP, SUMO, or thioredoxin tags to increase solubility

    • Co-expression with chaperones: GroEL/ES, DnaK/J to facilitate folding

    • Condition optimization: Lower induction temperature (16-20°C) to reduce inclusion body formation

  • Stability engineering:

    • Introduce stabilizing mutations identified through computational prediction

    • Remove oxidation-sensitive residues (Met, Cys) in non-critical positions

    • Consider surface entropy reduction by replacing flexible charged residues

  • Functional optimization:

    • Preserve GTP-binding pocket integrity

    • Maintain phosphorylation sites for regulatory studies

    • Consider the impact of any modifications on nucleotide binding and hydrolysis

Experimental data demonstrates that recombinant Toc34ΔTM252-6His can be successfully expressed in bacterial systems, yielding soluble protein with functional properties similar to the wild-type protein, including specific GTP binding that is enhanced by Mg²⁺ and can be competed by GTP and GDP but not ATP .

What are the most promising future research directions for TOC34 studies?

The field of TOC34 research has several promising directions that warrant further investigation:

  • Structural biology approaches:

    • Determine high-resolution structures of different TOC34 homologs

    • Obtain co-crystal structures with transit peptides to reveal recognition mechanisms

    • Investigate conformational changes upon GTP binding and phosphorylation

  • Systems-level understanding:

    • Comprehensive substrate profiling for different TOC34 homologs

    • Proteome-wide analyses of import pathways in different tissues and developmental stages

    • Integration of TOC34 function with cellular signaling networks

  • Evolutionary perspectives:

    • Comparative analysis of TOC34 homologs across plant species

    • Investigation of how TOC34 specialization correlates with plastid diversity

    • Understanding the evolutionary pressures that led to receptor diversification

  • Translational applications:

    • Engineering of TOC34 variants with modified substrate specificity

    • Development of tools to manipulate protein import for biotechnological applications

    • Exploration of TOC34 as a target for herbicide development

  • Integration with developmental biology:

    • Detailed analysis of how TOC34 isoforms contribute to plastid differentiation

    • Investigation of tissue-specific expression and regulation patterns

    • Understanding the coordination between nuclear gene expression and protein import

The discovery that plants contain multiple TOC34 homologs with distinct substrate preferences has opened new avenues for understanding how protein import is regulated during different developmental stages and in different tissues . Future research combining cutting-edge structural, biochemical, and genetic approaches will provide deeper insight into these sophisticated import mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.