Recombinant Arabidopsis thaliana Tryptophan N-monooxygenase 1 (CYP79B2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP79B2; At4g39950; T5J17.120; Tryptophan N-monooxygenase 1; Cytochrome P450 79B2; Tryptophan N-hydroxylase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP79B2
Target Protein Sequence
MNTFTSNSSDLTTTATETSSFSTLYLLSTLQAFVAITLVMLLKKLMTDPNKKKPYLPPGP TGWPIIGMIPTMLKSRPVFRWLHSIMKQLNTEIACVKLGNTHVITVTCPKIAREILKQQD ALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKRSEEND HLTAWVYNMVKNSGSVDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGGPTVEDVEHMEA MFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGKRT QIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILR KAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDTTVAGYHI PKGSQVLLSRYGLGRNPKVWADPLCFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAP ALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGDLRLPEHLYPTV K
Uniprot No.

Target Background

Function

CYP79B2 (Tryptophan N-monooxygenase 1) catalyzes the conversion of tryptophan to indole-3-acetaldoxime. This is a key precursor in the biosynthesis of tryptophan-derived glucosinolates and indole-3-acetic acid (IAA). Additionally, CYP79B2 is involved in the production of 4-hydroxyindole-3-carbonyl nitrile (4-OH-ICN), a cyanogenic metabolite crucial for inducible plant defense responses against pathogens.

Database Links

KEGG: ath:AT4G39950

STRING: 3702.AT4G39950.1

UniGene: At.20632

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Found in all tissues tested. Highest expression in roots, and low expression in stem.

Q&A

What is the primary biochemical function of CYP79B2?

CYP79B2 is a cytochrome P450 enzyme that catalyzes the conversion of tryptophan (Trp) to indole-3-acetaldoxime (IAOx). This conversion represents the first committed step in the biosynthesis of several tryptophan-derived secondary metabolites in Arabidopsis thaliana, including indole glucosinolates and the plant hormone indole-3-acetic acid (IAA) . The enzyme shows strict substrate specificity for tryptophan, similar to its counterpart CYP79A1 from Sorghum, with experimental evidence confirming that it does not effectively metabolize other substrates such as tyrosine or indole . This specificity is critical for channeling tryptophan into specialized metabolic pathways that contribute to plant development and defense responses.

How is CYP79B2 structurally characterized?

CYP79B2 belongs to the CYP79 family of cytochrome P450 enzymes. Structurally, it contains a predicted N-terminal chloroplast transit peptide that is not found in its Sorghum homolog CYP79A1 . The protein contains an N-terminal transmembrane domain characteristic of cytochrome P450 enzymes, which anchors it to cellular membranes. Sequence comparison reveals approximately 49% identity with CYP79A1 . For experimental manipulation, researchers often modify the N-terminal region by removing the predicted chloroplast transit peptide and substituting a different transmembrane domain to enable efficient expression in heterologous systems like E. coli .

Where is CYP79B2 expressed and localized in Arabidopsis?

CYP79B2 shows a broad expression pattern throughout Arabidopsis development rather than being restricted to specific tissues or stress conditions . The protein contains a chloroplast transit peptide in its N-terminal 22 amino acids, suggesting chloroplast localization . This subcellular localization is consistent with its role in secondary metabolism, as many biosynthetic pathways for plant specialized metabolites occur within plastids. The gene is notably expressed in root tissue, where it contributes to lateral root formation . Additionally, CYP79B2 expression is induced in response to pathogen infection, particularly after infection with virulent strains like P. syringae pv. maculicola (ES4326) .

What are the most effective methods for expressing recombinant CYP79B2?

Expression of recombinant CYP79B2 requires careful consideration of the protein's structural features, particularly its N-terminal region. Two primary expression systems have been documented:

Bacterial Expression (E. coli):
For E. coli expression, an N-terminally modified form (CYP79B2mod) is recommended. This modification involves:

  • Removal of the predicted chloroplast transit peptide

  • Substitution of a different transmembrane domain for the putative transmembrane domain of CYP79B2

  • Cloning into an appropriate expression vector such as pCWori+

The modified sequence can be created by replacing the first 90 bp of the coding region with a sequence encoding the first 14 amino acids of CYP17A1, using complementary oligonucleotides to create appropriate restriction sites (XhoI, HindIII, NdeI) . This approach enables efficient expression of functional P450s in E. coli.

Plant Expression:
For expression in plants, the full-length CYP79B2 cDNA can be subcloned using EcoRI into plant expression vectors like pBICaMV, which is derived from pBI121 . For detection of the recombinant protein in plant tissues, epitope tagging strategies can be employed. C-terminal tagging with c-myc has been shown to preserve enzymatic activity, whereas N-terminal tagging can significantly reduce activity .

How can CYP79B2 enzyme activity be measured in vitro?

The enzymatic activity of CYP79B2 can be measured through several approaches:

Radioactive Substrate Assay:

  • Prepare membrane extracts from E. coli expressing CYP79B2mod

  • Incubate the extracts with [14C]tryptophan as substrate

  • Separate the reaction products using thin-layer chromatography (TLC)

  • Analyze the formation of IAOx, which accumulates in a time-dependent manner

Control experiments should include:

  • Using extracts from uninduced E. coli cultures or E. coli expressing non-P450 cDNAs

  • Testing alternative substrates like [14C]tyrosine or [14C]indole to confirm substrate specificity

  • Comparison with authentic IAOx standards to confirm product identity

Product Identification:
The IAOx product can be identified by:

  • Comparing Rf values with published values for IAOx

  • Co-migration with partially purified IAOx standards

  • Mass spectrometry analysis for definitive identification

What experimental approaches can elucidate CYP79B2's role in auxin homeostasis?

Understanding CYP79B2's contribution to auxin homeostasis requires both genetic and biochemical approaches:

Genetic Manipulation Strategies:

  • Overexpression studies: Generate transgenic Arabidopsis lines overexpressing CYP79B2 under a constitutive promoter (e.g., 35S). These plants would be expected to show phenotypes associated with altered auxin levels, such as changes in root development .

  • Loss-of-function analysis: Analyze knockout mutants or RNAi lines targeting CYP79B2 to observe effects on auxin-dependent processes.

  • Complementation experiments: Introduce CYP79B2 into mutant backgrounds with disrupted auxin biosynthesis to test for functional rescue.

Biochemical Analysis:

  • Auxin quantification: Measure free IAA, conjugated IAA, and IAA precursors (particularly IAN) using sensitive analytical methods like liquid chromatography-mass spectrometry (LC-MS). Comparison between wild-type and genetically modified plants can reveal CYP79B2's contribution to auxin pools .

  • Metabolic flux analysis: Use isotope-labeled tryptophan to track the flow of metabolites through IAOx-dependent pathways.

Example findings from previous research:
In NIT1-overexpressing plants (which act downstream of CYP79B2), free IAA levels increased 2.3-fold (0.23 ± 0.03 nmol/g FW compared to 0.10 ± 0.01 nmol/g FW in wild-type), while IAN levels increased 3.5-fold (172 ± 18 nmol/g FW compared to 48 ± 13 nmol/g FW) . These biochemical changes correlated with altered root phenotypes, including 40% shorter primary roots and increased lateral root formation.

How is CYP79B2 expression regulated during plant development and stress responses?

CYP79B2 expression shows complex regulation patterns that can be studied through several approaches:

Developmental Regulation:

  • Expression profiling: Analyze CYP79B2 transcript levels across different tissues and developmental stages using quantitative RT-PCR or RNA-seq.

  • Promoter analysis: Identify regulatory elements in the CYP79B2 promoter using in silico analysis and validate through reporter gene constructs.

Stress-Induced Regulation:

  • Pathogen response: Northern blot or qRT-PCR analysis of CYP79B2 expression following pathogen infection shows induction 12.5 hours after infection with virulent Pseudomonas syringae pv. maculicola (ES4326) . This pattern parallels the induction of tryptophan biosynthetic genes (ASA1 and ASB1), suggesting coordinate regulation between tryptophan biosynthesis and metabolism .

  • Regulatory network analysis: Investigate the transcription factors controlling CYP79B2 expression during stress responses.

Experimental Design Considerations:

  • Include appropriate time course experiments when studying pathogen responses (e.g., 0h, 6h, 12h, 24h post-infection)

  • Include both virulent and avirulent pathogen strains for comparison

  • Use mock treatments as controls

  • Consider tissue-specific responses, as regulation may differ between tissues

What are the functional differences between CYP79B2 and other CYP79 family members?

The CYP79 family in Arabidopsis includes several members with distinct substrate preferences and roles:

CYP79B2 vs. CYP79B3:
Both CYP79B2 and CYP79B3 convert tryptophan to IAOx and appear to have overlapping functions . Genetic studies suggest some redundancy, as single mutants often show mild phenotypes compared to double mutants.

CYP79B2 vs. CYP79C1/C2:
CYP79C1 and CYP79C2 have broader substrate specificities, accepting multiple amino acids. For instance, CYP79C2 can produce both aromatic glucosinolates (BGLS) and aliphatic glucosinolates (2MP) .

Experimental approaches to compare CYP79 enzymes:

  • Heterologous expression systems: Express different CYP79 enzymes in Nicotiana benthamiana along with core pathway enzymes, then analyze the glucosinolate profiles to determine substrate preferences .

  • In vitro enzyme assays: Compare substrate specificity and kinetic parameters using purified enzymes and various amino acid substrates.

  • Complementation analysis: Introduce different CYP79 genes into cyp79b2/b3 double mutants to assess functional equivalence.

What are the optimal conditions for in vitro assays of recombinant CYP79B2?

Optimizing in vitro assays for CYP79B2 requires attention to several critical parameters:

Buffer Composition:

  • Use sodium phosphate buffer (typically 100 mM, pH 7.4)

  • Include NADPH as the electron donor (1-2 mM)

  • Add appropriate cofactors: NADPH-regenerating system (glucose-6-phosphate and glucose-6-phosphate dehydrogenase)

  • Consider adding detergents (e.g., 0.1% Triton X-100) to stabilize the membrane-bound enzyme

Reaction Conditions:

  • Temperature: Typically 30°C for plant cytochrome P450s

  • Incubation time: Monitor product formation at multiple time points (e.g., 15, 30, 60, 120 minutes) to establish linear range

  • Substrate concentration: Use [14C]tryptophan at concentrations ranging from 10-500 μM to determine kinetic parameters

  • Protein concentration: Adjust membrane extract concentration to ensure linear reaction kinetics

Product Analysis:

  • TLC conditions: Specify solvent systems that effectively separate IAOx from tryptophan and other metabolites

  • Controls: Include boiled enzyme controls and reactions with membrane preparations from non-induced cultures

How can researchers distinguish between IAOx-dependent and IAOx-independent auxin biosynthesis pathways?

Distinguishing between different auxin biosynthesis pathways requires a combination of genetic, biochemical, and analytical approaches:

Genetic Approaches:

  • Generate and analyze plants with mutations in multiple auxin biosynthetic pathways:

    • cyp79b2/cyp79b3 double mutants (block IAOx formation)

    • taa1/tar1/tar2 mutants (block IPyA pathway)

    • Cross these lines to generate higher-order mutants

  • Create reporter lines with auxin-responsive promoters (e.g., DR5::GUS) in different mutant backgrounds to visualize pathway-specific contributions to auxin signaling

Metabolic Analysis:

  • Precursor feeding studies: Supply labeled precursors (e.g., 13C-tryptophan, 13C-indole) to wild-type and pathway mutants, then trace the metabolic fate using mass spectrometry

  • Metabolite profiling: Quantify pathway intermediates (IAOx, IAN, IAM, IPyA) in different genetic backgrounds and under various conditions

  • Inhibitor studies: Use pathway-specific inhibitors to block individual routes of auxin biosynthesis

Experimental design considerations:

  • Consider tissue specificity and developmental timing, as the relative contribution of different pathways may vary

  • Analyze both free IAA and conjugated forms

  • Include appropriate controls for extraction efficiency and stability of labile intermediates

What approaches can be used to study protein-protein interactions involving CYP79B2?

Understanding the protein interaction network of CYP79B2 can provide insights into its regulation and metabolic channeling:

In vivo Approaches:

  • Bimolecular Fluorescence Complementation (BiFC): Split YFP fragments are fused to CYP79B2 and potential interaction partners, then co-expressed in plant cells to visualize interactions through restored fluorescence

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged CYP79B2 (e.g., CYP79B2:c-myc) to pull down interacting proteins from plant extracts, followed by mass spectrometry identification

  • Förster Resonance Energy Transfer (FRET): Fuse CYP79B2 and potential partners with appropriate fluorophores to detect molecular proximity in vivo

In vitro Approaches:

  • Pull-down assays: Use purified recombinant CYP79B2 (potentially with modifications for solubility) as bait to identify interacting proteins

  • Surface Plasmon Resonance (SPR): Immobilize CYP79B2 on sensor chips to measure binding kinetics with purified candidate proteins

Potential interaction partners to investigate:

  • Other enzymes in the glucosinolate and auxin biosynthetic pathways

  • Cytochrome P450 reductases that supply electrons for catalysis

  • Membrane scaffolding proteins that may organize metabolic complexes

  • Regulatory proteins that might modulate CYP79B2 activity

How can CRISPR-Cas9 genome editing be applied to study CYP79B2 function?

CRISPR-Cas9 technology offers powerful approaches to investigate CYP79B2 function through precise genetic modifications:

Knockout Strategies:

  • Design sgRNAs targeting exonic regions of CYP79B2, preferably early in the coding sequence

  • Create single cyp79b2 knockouts and combine with cyp79b3 mutations to overcome potential redundancy

  • Screen transformants using PCR-based genotyping and sequencing to identify frameshift mutations

Domain-specific Modifications:

  • Generate targeted mutations in functional domains (e.g., substrate binding pocket, membrane-targeting domain)

  • Create chimeric enzymes by swapping domains between CYP79B2 and other CYP79 family members using homology-directed repair

  • Introduce specific amino acid changes to test hypotheses about catalytic mechanisms

Promoter Editing:

  • Modify CYP79B2 regulatory regions to alter expression patterns

  • Introduce reporter genes (e.g., GFP) at the endogenous locus to monitor native expression

  • Create conditional alleles by introducing inducible elements

Experimental design considerations:

  • Analyze multiple independent lines to control for off-target effects

  • Include comprehensive phenotypic characterization (morphological, metabolic, transcriptomic)

  • Validate editing outcomes at both DNA and protein levels

  • Consider potential compensatory mechanisms that may mask phenotypes

How should researchers interpret contradictory results regarding CYP79B2's contribution to auxin biosynthesis?

Research on CYP79B2's role in auxin biosynthesis has sometimes yielded seemingly contradictory results. When facing such contradictions, consider:

Possible Sources of Variation:

Systematic Approach to Resolve Contradictions:

  • Directly compare different genetic materials under identical conditions

  • Employ multiple, complementary analytical methods

  • Conduct time-course experiments to capture dynamic changes

  • Analyze tissue-specific effects rather than whole-plant measurements

  • Consider compensatory mechanisms that may mask phenotypes in long-term experiments

For example, studies of nitrilase (NIT) overexpression, which acts downstream of CYP79B2, have shown that alterations in the pathway can lead to complex changes in multiple metabolites. NIT1 overexpression increased both free IAA and its precursor IAN, suggesting feedback regulation within the pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.