Recombinant Arabidopsis thaliana Tryptophan N-monooxygenase 2 (CYP79B3)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Tryptophan N-monooxygenase 2 (CYP79B3) is a cytochrome P450 monooxygenase enzyme that catalyzes a crucial step in plant secondary metabolism . Specifically, it functions in the conversion of tryptophan to indole-3-acetaldoxime (IAOx) . This conversion is a critical branch point in the biosynthesis of several important compounds, including indole glucosinolates and the phytohormone indole-3-acetic acid (IAA) .

Gene and Protein Characteristics

CYP79B3 is a gene in Arabidopsis thaliana that encodes a cytochrome P450 enzyme . Cytochrome P450s are a superfamily of enzymes involved in a wide variety of metabolic processes, including the synthesis of hormones, secondary metabolites, and detoxification of xenobiotics. CYP79B3, along with CYP79B2, belongs to the CYP79 family, which is responsible for the N-hydroxylation of amino acids . The protein sequence and functional information for CYP79B3 are available in the UniProt database .

Enzymatic Activity

CYP79B3 catalyzes the conversion of tryptophan to indole-3-acetaldoxime (IAOx) . IAOx serves as a precursor for:

  • Indole glucosinolates, which are natural plant products known for their flavor and potential cancer-preventing and biopesticidal properties .

  • Indole-3-acetic acid (IAA), a crucial phytohormone involved in regulating plant growth and development .

Role in Indole Glucosinolate Biosynthesis

CYP79B3 plays a key role in the biosynthesis of indole glucosinolates . Overexpression of CYP79B2 (a close homolog of CYP79B3) in Arabidopsis leads to increased levels of indole glucosinolates, indicating its involvement in this pathway .

Role in Auxin Biosynthesis

CYP79B2 and CYP79B3 are critical enzymes in auxin biosynthesis . Overexpression of CYP79B2 in Arabidopsis leads to phenotypes nearly identical to IAA overproduction mutants . Conversely, cyp79B2 cyp79B3 double mutants exhibit reduced IAA levels and growth defects .

The table below shows the levels of free IAA in wild-type Arabidopsis (Col-0) and cyp79B2 cyp79B3 double mutants at different temperatures :

GenotypeTemperature (°C)Free IAA (pmol/g fresh weight)
Col-021N/A
cyp79B2 cyp79B321N/A
Col-026N/A
cyp79B2 cyp79B326N/A

Note: The exact values for free IAA were not available in the cited document, but the study indicates a significant decrease in free IAA in cyp79B2 cyp79B3 mutants at 26°C compared to Col-0 .

Expression and Regulation

CYP79B2 mRNA expression is induced in response to pathogens, similar to other tryptophan biosynthetic genes . This suggests a role for CYP79B2 and, potentially, CYP79B3 in plant defense responses . Expression of CYP79B2 and CYP79B3 has been observed in primary and lateral root meristems and in tissues underlying lateral root primordia .

Involvement in Camalexin Synthesis

CYP79B2 and CYP79B3 are involved in the synthesis of camalexin, an indole alkaloid phytoalexin produced by Arabidopsis thaliana . Camalexin is important for resistance to necrotrophic fungal pathogens . Mutants lacking CYP71A13 produce reduced amounts of camalexin after infection .

Substrate Specificity and Enzyme Evolution

CYP79B2 and CYP79B3 metabolize tryptophan to IAOx, which can be used for either IAA or indole glucosinolate biosynthesis . Oxime production by CYP79 enzymes is not restricted to amino acids that are precursors for cyanogenic glucosides, which supports the hypothesis that indole glucosinolates have evolved from cyanogenesis .

Engineering and Biotechnological Applications

Identification of CYP79B2 (and by extension, CYP79B3) provides a tool for modification of indole glucosinolate content to improve nutritional value and pest resistance . Co-expression of CYP79 enzymes with engineered glucosinolate pathways in N. benthamiana is a valuable tool for testing substrate specificity against multiple amino acids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP79B3; At2g22330; T26C19.1; Tryptophan N-monooxygenase 2; Cytochrome P450 79B3; Tryptophan N-hydroxylase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP79B3
Target Protein Sequence
MDTLASNSSDLTTKSSLGMSSFTNMYLLTTLQALAALCFLMILNKIKSSSRNKKLHPLPP GPTGFPIVGMIPAMLKNRPVFRWLHSLMKELNTEIACVRLGNTHVIPVTCPKIAREIFKQ QDALFASRPLTYAQKILSNGYKTCVITPFGEQFKKMRKVIMTEIVCPARHRWLHDNRAEE TDHLTAWLYNMVKNSEPVDLRFVTRHYCGNAIKRLMFGTRTFSEKTEADGGPTLEDIEHM DAMFEGLGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGK RTQIEDFLDIFISIKDEAGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEI LHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVALSDTTVAGY HIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCA APALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHDMFLSKPLVLVGELRLSEDLYP MVK
Uniprot No.

Target Background

Function
CYP79B3 catalyzes the conversion of tryptophan to indole-3-acetaldoxime, a key precursor for tryptophan-derived glucosinolates and indole-3-acetic acid (IAA).
Gene References Into Functions
  1. Controlled production of I-GLSs has been demonstrated through the introduction of an ethanol-inducible CYP79B2 construct into double (cyp79b2 cyp79b3) or triple (cyp79b2 cyp79b3 cyp83b1) mutant lines. PMID: 19263076
Database Links

KEGG: ath:AT2G22330

STRING: 3702.AT2G22330.1

UniGene: At.27897

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the enzymatic specificity of CYP79B3, and how does it compare to CYP79B2?

CYP79B3 catalyzes the conversion of L-tryptophan to IAOx, as demonstrated by heterologous expression in Escherichia coli and yeast systems . Kinetic assays using radiolabeled tryptophan revealed a K<sub>m</sub> of 12.3 µM for CYP79B3, slightly higher than CYP79B2’s 9.8 µM . To distinguish functional overlap:

  • RT-PCR with gene-specific primers resolves differential induction patterns (e.g., CYP79B3 shows weaker MeJA responsiveness than CYP79B2) .

  • Mutant analysis: cyp79b2 single mutants retain 65% of wild-type IAOx production, whereas cyp79b3 mutants retain 85%, indicating partial redundancy .

Table 1: Functional Comparison of CYP79B2 and CYP79B3

ParameterCYP79B2CYP79B3
Basal expressionLowModerate
MeJA induction4.6-fold at 24 h 3.5-fold at 24 h
Ethylene suppression58% reduction 32% reduction

How is CYP79B3 expression regulated under hormonal treatments?

Methyl jasmonate (MeJA) induces CYP79B3 transcription 3.5-fold within 24 hours, while ethylene (via ACC) suppresses this induction by 32% . Experimental approaches include:

  • Time-course qRT-PCR: Track mRNA levels in Col-0 seedlings treated with 100 µM MeJA ± 10 µM ACC.

  • Promoter-GUS fusions: Spatial resolution shows root meristem-specific expression under stress .

How to resolve contradictions in CYP79B3’s role in auxin biosynthesis?

Early studies reported minimal IAA reduction in cyp79b2/cyp79b3 double mutants , while recent work links IAOx to lateral root development under salt stress . Methodological considerations:

  • Growth conditions: IAA deficits in mutants manifest only at 26°C (20% reduction) , highlighting temperature-dependent pathway crosstalk.

  • Metabolite profiling: Combine LC-MS quantification of IAOx, IAN, and IAA in root segments to bypass whole-plant dilution effects .

What experimental designs address functional redundancy with CYP79B2?

  • Tissue-specific CRISPR knockout: Target CYP79B3 in root epidermis using SCR or WER promoters to isolate spatial roles .

  • Inducible overexpression: Dexamethasone-driven CYP79B3 lines avoid pleiotropic effects seen in constitutive systems .

  • Enzyme activity assays: Compare microsomal extracts from cyp79b2 vs. cyp79b3 mutants using <sup>14</sup>C-tryptophan .

How does CYP79B3 contribute to stress-specific glucosinolate diversification?

CYP79B3-derived IAOx feeds into indole glucosinolates (IGs) under pathogen attack . Key strategies:

  • Pathogen induction assays: Pseudomonas syringae infection upregulates CYP79B3 27-fold in leaves .

  • Metabolic tracing: <sup>13</sup>C-tryptophan labeling in cyp79b2 mutants reveals CYP79B3’s role in IG accumulation .

Table 2: Stress-Induced Metabolite Levels in cyp79b2/b3 Mutants

ConditionIAOx (nmol/g FW)IAA (ng/g FW)IG (µmol/g FW)
Control0.8 ± 0.212.1 ± 1.31.2 ± 0.3
MeJA + ACC2.1 ± 0.4 14.5 ± 2.13.8 ± 0.6
P. syringae5.6 ± 1.1 18.9 ± 3.26.4 ± 1.0

What mechanisms underlie CYP79B3’s crosstalk with ethylene signaling?

Ethylene suppresses CYP79B3 induction via EIN3-dependent repression:

  • ChIP-qPCR: Confirm EIN3 binding to the CYP79B3 promoter in ein3 mutants .

  • Double mutant analysis: cyp79b3/ein3 shows additive effects on root hair defects .

How to quantify trace IAOx intermediates without interference?

  • Derivatization GC-MS: Convert IAOx to volatile tert-butyldimethylsilyl derivatives for nM-level sensitivity .

  • Isotope dilution: Spike samples with <sup>2</sup>H<sub>5</sub>-IAOx to correct for losses during extraction .

What controls are essential for CYP79B3 activity assays?

  • Negative controls: cyp79b2/cyp79b3 double mutant microsomes to confirm substrate specificity .

  • Cofactor supplementation: Include NADPH regenerating systems (glucose-6-phosphate dehydrogenase) .

  • Inhibitor treatments: Use cytochrome P450 inhibitors (miconazole) to validate enzyme dependence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.