Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 32 (UBC32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UBC32; At3g17000; K14A17.7; Ubiquitin-conjugating enzyme E2 32; E2 ubiquitin-conjugating enzyme 32; Ubiquitin carrier protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
UBC32
Target Protein Sequence
MADERYNRKNPAVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIY HGRIQLPADYPFKPPSFMLLTPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAF MPTSPNGALGSVDYPKDERRTLAIKSRETPPKYGSPERQKIIDEIHQYILSKATVVPKPL PLECSQAPSIVSEAHSQVEPQEAITVVEERSIATTDTIVDDQIIEETAEAVNTAASVVPA AAPLPAVEVVVKASVSGEQRMARRAAQKPVDDRLFTWAAVGLTIAIMVLLLKKFIKSNGY STGFMDDQS
Uniprot No.

Target Background

Function
This protein accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.
Gene References Into Functions
  1. UBC32 negatively regulates the stability of AtOS9, a component of the HRD1 complex. PMID: 28040559
  2. The plant ubiquitin-conjugating enzyme 32 (UBC32), an ER-bound E2 enzyme functioning within the DOA10 complex, is maintained at low levels under standard conditions via proteasome-mediated degradation facilitated by the HRD1 complex, another E3 complex involved in ER-associated degradation (ERAD). PMID: 27322605
  3. UBC32 mediates oxidative stress tolerance. PMID: 22884097
  4. Evidence suggests UBC32 plays a role in the brassinosteroid (BR)-mediated salt stress response, and that BR signaling is crucial for plant salt tolerance. PMID: 22214659
Database Links

KEGG: ath:AT3G17000

STRING: 3702.AT3G17000.1

UniGene: At.6347

Protein Families
Ubiquitin-conjugating enzyme family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does UBC32 function in the ERAD pathway?

UBC32 functions as a ubiquitin-conjugating enzyme (E2) in the ERAD pathway, which is responsible for recognizing, ubiquitinating, and ultimately degrading misfolded proteins in the endoplasmic reticulum. UBC32 works in conjunction with E3 ligases, particularly DOA10B in Arabidopsis, to facilitate the transfer of ubiquitin to substrate proteins targeted for degradation .

In vivo studies have demonstrated that UBC32 affects the stability of known ERAD substrates such as the barley MLO-12 mutant protein. Overexpression of UBC32-GFP results in reduced amounts of MLO-12, while expression of the catalytically inactive UBC32(C93S) mutant leads to increased accumulation of MLO-12 . This degradation process is mediated by the 26S proteasome, as treatment with the proteasome inhibitor MG132 results in MLO-12 accumulation even in the presence of overexpressed UBC32 .

What are the most effective methods for studying UBC32 localization in plant cells?

Several complementary approaches have proven effective for determining UBC32 subcellular localization:

  • GFP Fusion Protein Expression: Creating a UBC32-GFP fusion construct driven by the cauliflower mosaic virus 35S promoter and introducing it into wild-type Arabidopsis plants. Confocal microscopy can then be used to visualize the localization pattern .

  • Co-localization with Established Markers: Confirming ER localization by co-expressing UBC32-GFP with an ER marker such as HDEL-RFP. The overlapping fluorescence patterns provide strong evidence for ER membrane localization .

  • Transient Expression Systems: Both stable transgenic plants and transient expression in Nicotiana benthamiana leaves can be used to verify localization. The transient expression system is particularly useful for rapid preliminary assessments before investing in stable transgenic lines .

  • Subcellular Fractionation: Biochemical fractionation of cellular components followed by western blot analysis can provide additional confirmation of the membrane association of UBC32.

These methods have consistently demonstrated that UBC32 localizes to the ER membrane, consistent with its function in the ERAD pathway .

How can researchers effectively express and purify recombinant UBC32 protein for in vitro studies?

For efficient expression and purification of recombinant UBC32:

  • Expression System Selection: E. coli has proven effective for producing recombinant UBC32. The full-length protein (amino acids 1-309) can be expressed with an N-terminal His tag to facilitate purification .

  • Purification Protocol:

    • Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resins for initial purification

    • Follow with size exclusion chromatography to achieve >90% purity as determined by SDS-PAGE

    • Obtain the protein in lyophilized powder form for stability

  • Storage Considerations:

    • Avoid repeated freezing and thawing cycles

    • Store working aliquots at 4°C

    • For long-term storage, maintain at -80°C in buffer containing glycerol as a cryoprotectant

  • Functional Verification: Test the catalytic activity of purified UBC32 using in vitro ubiquitination assays to ensure that the recombinant protein retains its enzymatic function.

These approaches enable the production of high-quality recombinant UBC32 suitable for biochemical characterization, enzymatic assays, and structural studies .

What techniques are most effective for studying UBC32 protein-protein interactions?

Multiple complementary techniques have been successfully employed to study UBC32 protein interactions:

  • Luciferase Complementation Imaging Assay: This in vivo method involves fusing UBC32 and its potential interaction partner (e.g., DOA10B) with N-terminal and C-terminal luciferase fragments, respectively. When expressed in Nicotiana benthamiana leaves, luciferase activity is only reconstituted if the proteins interact .

  • Co-immunoprecipitation (Co-IP): This approach can confirm interactions in plant cells (either protoplasts or intact tissues). For example, SGD1-HA and SiUBC32-FLAG co-immunoprecipitate when co-expressed in Setaria italica leaf protoplasts .

  • Yeast Two-Hybrid (Y2H) Assays: Useful for initial screening of potential interacting partners, though confirmation with in planta methods is recommended for plant proteins .

  • GST Pull-Down Assays: These in vitro assays provide additional evidence for direct protein interactions. The technique has been successfully used to demonstrate the interaction between SGD1 and SiUBC32 .

  • Bimolecular Fluorescence Complementation (BiFC): While not mentioned in the search results, this technique is complementary to luciferase complementation and can provide spatial information about where in the cell the interaction occurs.

These methods have successfully identified interactions between UBC32 and E3 ligases, confirming its role in the ubiquitination pathway .

How does UBC32 contribute to salt stress tolerance in Arabidopsis?

UBC32 plays a significant role in regulating salt stress tolerance through its connection to brassinosteroid (BR) signaling. The mechanism involves:

  • Gene Expression Regulation: The UBC32 gene is highly induced by salt (NaCl) treatment, suggesting a direct response to salt stress conditions .

  • Phenotypic Effects:

    • ubc32 mutants display enhanced salt tolerance compared to wild-type plants

    • When grown on medium containing 125 mM NaCl, approximately 62% of ubc32 mutants remain green with true leaves, compared to lower percentages in wild-type plants

    • Conversely, 35S-UBC32 overexpression lines show reduced tolerance to salt stress

  • BR Signaling Connection: UBC32 mutation causes accumulation of bri1-5 and bri1-9 (mutant forms of the BR receptor), which subsequently activates BR signal transduction. This genetic and physiological evidence supports that UBC32 regulates salt stress response through BR-mediated pathways .

  • Salt-Specific Response: The enhanced tolerance in ubc32 mutants is specific to salt stress rather than general ionic or osmotic stress, indicating a specialized role in salt stress signaling pathways .

These findings suggest that UBC32 acts as a negative regulator of salt stress tolerance by modulating BR receptor stability through the ERAD pathway, with lower UBC32 activity resulting in enhanced salt tolerance .

What is the relationship between UBC32 and ER stress response?

UBC32 functions as a critical component connecting ER stress responses to protein quality control through the ERAD pathway:

  • Induction by ER Stressors: UBC32 expression is significantly induced by various ER stress-causing agents, including:

    • L-azetidine-2-carboxylic acid (AZC)

    • Tunicamycin (Tm)

    • DTT

  • ER Stress Tolerance Phenotypes:

    • ubc32 mutants show enhanced tolerance to tunicamycin, with higher true leaf emergence rates and lower proportions of dead seedlings compared to wild-type plants

    • 35S-UBC32 overexpression plants display increased sensitivity to tunicamycin

    • These phenotypic differences are specific to ER stress, as no major differences are observed on control plates

  • Molecular Mechanism: As an ERAD component, UBC32 facilitates the ubiquitination and subsequent degradation of misfolded proteins that accumulate during ER stress, thereby helping to maintain ER homeostasis .

  • Integration with Stress Signaling: UBC32 appears to integrate ER stress responses with other cellular processes, including BR signaling, providing a mechanistic link between protein quality control and broader stress adaptation responses .

These findings establish UBC32 as an important mediator of ER stress responses in plants, with potential implications for engineering improved stress tolerance in crops .

How does UBC32 interact with brassinosteroid signaling pathways?

UBC32 has a sophisticated relationship with brassinosteroid (BR) signaling through its function in the ERAD pathway:

  • Regulation of BR Receptor Stability:

    • UBC32 affects the stability of mutant forms of the BR receptor BRASSINOSTEROID INSENSITIVE 1 (BRI1)

    • Specifically, ubc32 mutation causes the accumulation of bri1-5 and bri1-9 (mutant forms of BRI1)

    • This accumulation subsequently activates BR signal transduction

  • Phenotypic Effects:

    • ubc32 mutants show phenotypes consistent with enhanced BR signaling, including better growth under salt stress conditions

    • The molecular connection between UBC32 and BR signaling is supported by genetic and physiological data

  • Integration with Transcription Factors:

    • Research has shown that transcription factors bZIP17 and bZIP28 activate both ER chaperone genes and BR signaling

    • UBC32 may represent a direct molecular link between ERAD and BR signaling activation

  • Mechanistic Model: Based on the available data, the following model can be proposed:

    • Under normal conditions, UBC32 facilitates the degradation of mutant or misfolded BR receptors

    • Under stress conditions, modulation of UBC32 activity affects BR receptor accumulation

    • This accumulation enhances BR signaling, contributing to stress tolerance

    • The pathway provides a mechanism by which an ERAD component can regulate both growth and stress responses

This connection between UBC32 and BR signaling represents an important mechanism through which plants integrate protein quality control with hormone signaling to optimize growth under stress conditions .

How do UBC32 homologs function in crop species compared to Arabidopsis?

Research on UBC32 homologs in crop species has revealed both conserved and species-specific functions:

  • Setaria italica (Foxtail Millet):

    • The SiUBC32 ortholog (Seita.9G428900) shows similar localization to the ER membrane as in Arabidopsis

    • SiUBC32 interacts with SGD1, suggesting a conserved protein interaction network

    • Like Arabidopsis UBC32, it appears to be involved in stress tolerance and growth regulation

  • Conservation of Key Features:

    • ER membrane localization appears to be conserved across species

    • The role in improving stress tolerance and BR-mediated growth seems consistent between Arabidopsis and Setaria italica

    • Spatiotemporal expression patterns show similarities between species

  • Functional Implications in Crops:

    • In Setaria italica, the UBC32-SGD1 interaction contributes to seed size control, a trait of significant agricultural importance

    • This suggests that UBC32 homologs may have additional or specialized roles in crop species related to agronomically important traits

  • Evolutionary Conservation:

    • Phylogenetic analysis places UBC32 and its homologs in two subfamilies similar to those in metazoa

    • UBC32 is similar to the UBE2J1 subfamily, while UBC33 and UBC34 belong to the UBE2J2 subfamily

    • This evolutionary conservation suggests fundamental importance of these proteins across diverse plant species

These findings indicate that while the basic molecular function of UBC32 is likely conserved across species, its integration into species-specific developmental and stress response pathways may vary, presenting opportunities for crop improvement through targeted manipulation of these pathways .

What approaches can be used to study the effect of UBC32 post-translational modifications on its activity?

Investigating post-translational modifications (PTMs) of UBC32 requires sophisticated approaches:

  • Mass Spectrometry-Based Proteomics:

    • Tandem mass spectrometry (MS/MS) can identify specific PTMs on purified UBC32

    • Techniques such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) can compare modification patterns under different conditions

    • Phosphorylation, ubiquitination, and other modifications can be mapped to specific residues

  • Site-Directed Mutagenesis:

    • Generate UBC32 variants where potential modification sites are mutated (e.g., Ser/Thr to Ala for phosphorylation sites)

    • Assess the functional consequences in vivo by expressing these variants in ubc32 mutant backgrounds

    • Analyze phenotypic outcomes under various stress conditions to determine functional significance

  • In Vitro Enzymatic Assays:

    • Develop assays to measure ubiquitin conjugation activity of UBC32 variants

    • Compare wild-type and modified forms of the enzyme under standardized conditions

    • Quantify differences in enzymatic parameters like Km and Vmax

  • Structural Studies:

    • Use X-ray crystallography or cryo-EM to determine how PTMs affect UBC32 structure

    • Model potential conformational changes induced by specific modifications

    • Correlate structural insights with functional outcomes

  • PTM-Specific Antibodies:

    • Develop antibodies that specifically recognize modified forms of UBC32

    • Use these for western blotting to monitor modification status under different conditions

    • Employ immunoprecipitation to isolate specifically modified forms for further analysis

These approaches would provide critical insights into how UBC32 activity is regulated post-translationally during various stress responses and developmental stages .

How can CRISPR/Cas9 technology be applied to study UBC32 function in different plant species?

CRISPR/Cas9 technology offers powerful approaches for investigating UBC32 function across plant species:

  • Targeted Gene Knockout:

    • Design sgRNAs targeting conserved regions of UBC32 orthologs

    • Generate complete knockout lines to assess null phenotypes

    • Compare phenotypic effects across species to identify conserved and divergent functions

    • Analyze stress responses, particularly salt tolerance and ER stress sensitivity

  • Domain-Specific Modifications:

    • Create precise mutations in functional domains:

      • Target the catalytic cysteine (Cys93 in Arabidopsis) to disrupt enzymatic activity while maintaining protein structure

      • Modify the transmembrane domain to affect ER localization

      • These changes can help dissect domain-specific functions

  • Base Editing Applications:

    • Use base editors to introduce specific amino acid changes without creating double-strand breaks

    • Generate series of variants with subtle modifications to map structure-function relationships

    • Correlate specific residue changes with phenotypic outcomes

  • Promoter Modifications:

    • Modify the UBC32 promoter to alter its expression pattern or stress responsiveness

    • Create variants with enhanced or reduced stress induction

    • Assess how altered expression patterns affect plant stress tolerance

  • Tagged Versions for In Vivo Studies:

    • Use homology-directed repair to introduce epitope tags or fluorescent proteins at the endogenous locus

    • Create lines expressing UBC32 with C-terminal GFP tag under native regulation

    • Use these lines for more physiologically relevant localization and interaction studies

These CRISPR-based approaches would significantly advance our understanding of UBC32 function across plant species and potentially lead to improved stress tolerance in crop plants .

What are common challenges in assessing UBC32 enzymatic activity and how can they be addressed?

Researchers studying UBC32 enzymatic activity face several challenges:

  • Background Ubiquitination Activity:

    • Challenge: When using plant-expressed substrates for in vitro ubiquitination assays, background activity from endogenous plant UBC32 homologs may occur, as observed with MLO-12 .

    • Solution: Use bacterial expression systems for substrates to eliminate plant-derived background activity. Alternatively, perform assays in the presence of specific inhibitors or under conditions where endogenous activity is minimized.

  • Membrane Protein Purification:

    • Challenge: UBC32's C-terminal transmembrane domain makes it difficult to purify in native form.

    • Solution: Express truncated versions lacking the transmembrane domain for enzymatic studies, or use specialized detergent-based purification protocols for full-length protein .

  • Maintaining Enzymatic Activity:

    • Challenge: Recombinant E2 enzymes may lose activity during purification or storage.

    • Solution: Add stabilizing agents such as DTT to prevent oxidation of the catalytic cysteine. Store enzymes in small aliquots to avoid repeated freeze-thaw cycles. Consider rapid activity assays immediately after purification .

  • Substrate Specificity Determination:

    • Challenge: Identifying physiological substrates of UBC32 beyond known ERAD substrates.

    • Solution: Combine protein interaction studies (immunoprecipitation followed by mass spectrometry) with comparative proteomics of wild-type and ubc32 mutant plants to identify proteins whose stability is affected by UBC32 .

  • Quantification of Activity:

    • Challenge: Precisely measuring ubiquitination rates in complex reaction mixtures.

    • Solution: Develop fluorescence-based real-time assays using labeled ubiquitin to monitor reaction kinetics. Alternatively, use western blotting with anti-ubiquitin antibodies followed by densitometry for semi-quantitative analysis .

Addressing these challenges will enable more accurate characterization of UBC32's enzymatic properties and substrate specificity .

What experimental controls are essential when studying the effects of UBC32 on protein stability?

When investigating UBC32's effects on protein stability, several critical controls must be included:

  • Transcript Level Verification:

    • Control: RT-PCR or qRT-PCR to measure mRNA levels of target proteins

    • Purpose: Ensures that observed protein level changes are due to post-transcriptional mechanisms rather than altered gene expression

    • Example: In UBC32 studies, mRNA levels of MLO-12 were analyzed by RT-PCR to confirm equal expression across experimental conditions

  • Proteasome Inhibition Controls:

    • Control: Treatment with proteasome inhibitors (e.g., MG132)

    • Purpose: Verifies that observed protein degradation is proteasome-dependent

    • Example: MG132 treatment resulted in MLO-12 accumulation even in UBC32-GFP overexpression conditions, confirming proteasome involvement

  • Catalytically Inactive Mutants:

    • Control: Expression of UBC32 with mutated catalytic site (C93S)

    • Purpose: Distinguishes between catalytic and scaffold functions of UBC32

    • Example: UBC32(C93S)-GFP expression led to increased substrate accumulation, confirming the importance of catalytic activity

  • Localization Controls:

    • Control: Verification that mutation of catalytic sites doesn't affect protein localization

    • Purpose: Ensures that functional differences aren't due to mislocalization

    • Example: Both UBC32-GFP and UBC32(C93S)-GFP showed identical ER localization patterns

  • Loading/Expression Controls:

    • Control: Internal standards for protein expression (e.g., HA-GFP)

    • Purpose: Normalizes for transfection/expression efficiency variations

    • Example: HA-GFP was detected as an internal control in co-infiltration experiments

  • Parallel Analysis of Multiple Substrates:

    • Control: Testing known ERAD substrates alongside experimental proteins

    • Purpose: Confirms that the ERAD pathway is functioning as expected

    • Example: Using established ERAD substrates like MLO-12 as positive controls when testing new potential substrates

These controls ensure that observed effects on protein stability can be confidently attributed to UBC32's enzymatic activity in the ERAD pathway .

What are the most effective phenotypic assays for evaluating UBC32 function in stress response?

To effectively evaluate UBC32's role in stress responses, researchers should employ these phenotypic assays:

  • Salt Stress Tolerance Assays:

    • Methodology: Transfer 2-day-old seedlings to medium containing 125 mM NaCl and evaluate after 9 days

    • Measurements:

      • Percentage of green seedlings with true leaves

      • Percentage of yellow seedlings without true leaves

      • Percentage of pale seedlings

    • Expected Results: ubc32 mutants show ~62% green seedlings compared to lower percentages in wild-type and overexpression lines

  • ER Stress Response Assays:

    • Methodology: Transfer 2-day-old seedlings to medium containing tunicamycin (0.45 μg/mL) and evaluate after 4 days

    • Measurements:

      • True leaf emergence rates

      • Proportion of dead seedlings with yellow cotyledons

    • Expected Results: ubc32 mutants show higher true leaf emergence and lower proportions of dead seedlings compared to wild-type and overexpression lines

  • Root Growth Assays:

    • Methodology: Grow seedlings vertically on half-strength MS medium with or without stress agents

    • Measurements:

      • Primary root length

      • Lateral root development

    • Expected Results: 35S-UBC32 lines exhibit slightly shorter primary roots even under normal conditions

  • ABA Sensitivity Tests:

    • Methodology: Germination and post-germination growth on medium containing ABA

    • Measurements:

      • Germination rate

      • Cotyledon greening

      • Early seedling development

    • Expected Results: ubc32 lines show more insensitivity to ABA than wild-type plants, while 35S-UBC32 lines are more sensitive

  • Comparative Analysis Across Multiple Stressors:

    • Methodology: Test responses to ionic stress (NaCl), osmotic stress (mannitol), and ER stress (tunicamycin) in parallel

    • Measurements: Comprehensive phenotypic analysis under each condition

    • Purpose: Distinguishes between general stress tolerance and stress-specific responses

    • Expected Results: ubc32 shows specific tolerance to salt stress rather than general osmotic stress

These assays provide comprehensive evaluation of UBC32's role in various stress responses and can distinguish between its functions in different signaling pathways .

What are the most promising applications of UBC32 research for crop improvement?

Based on current understanding of UBC32 function, several promising applications for crop improvement emerge:

  • Enhanced Salt Stress Tolerance:

    • Approach: Modulate UBC32 expression or activity in crop species through gene editing or breeding for reduced function

    • Potential Benefit: Improved crop performance in saline soils, which constitute a significant portion of agricultural land worldwide

    • Supporting Evidence: ubc32 mutants in Arabidopsis show significantly enhanced salt tolerance

  • Optimization of Seed Size and Yield:

    • Approach: Fine-tune the interaction between UBC32 homologs and their partners (like SGD1 in Setaria italica)

    • Potential Benefit: Increased seed size and potentially improved yield in grain crops

    • Supporting Evidence: The UBC32 ortholog in Setaria italica (SiUBC32) contributes to seed size control through interaction with SGD1

  • Improved ER Stress Tolerance:

    • Approach: Modulate UBC32 activity to enhance cellular responses to ER stress conditions

    • Potential Benefit: Crops with better performance under conditions that trigger ER stress, such as extreme temperatures or certain pathogens

    • Supporting Evidence: ubc32 mutants show enhanced tolerance to tunicamycin-induced ER stress

  • Engineering Brassinosteroid Signaling:

    • Approach: Control BR receptor accumulation through targeted UBC32 modifications

    • Potential Benefit: Optimized growth and development under variable environmental conditions

    • Supporting Evidence: UBC32 affects BR receptor stability and subsequent BR signaling activation

  • Broad Stress Resilience:

    • Approach: Create variants with modified stress-responsive expression patterns

    • Potential Benefit: Crops that can better withstand multiple stresses while maintaining productivity

    • Supporting Evidence: UBC32 connects multiple stress response pathways, including salt stress, ER stress, and hormone signaling

These applications represent promising directions for translating fundamental UBC32 research into practical crop improvement strategies, potentially contributing to food security under changing environmental conditions .

What techniques are emerging for studying UBC32 protein dynamics in living cells?

Several cutting-edge techniques are emerging for real-time analysis of UBC32 dynamics:

  • Advanced Live Cell Imaging:

    • Super-resolution microscopy: Techniques like PALM, STORM, or STED can visualize UBC32 distribution at the ER membrane with nanometer precision

    • Multi-color imaging: Simultaneous visualization of UBC32 with interaction partners and substrates using spectrally distinct fluorescent proteins

    • FRAP (Fluorescence Recovery After Photobleaching): Measures mobility and binding dynamics of UBC32 at the ER membrane

  • Protein Lifetime and Turnover Analysis:

    • Fluorescent timers: Engineered proteins that change color over time can reveal UBC32 protein age and turnover rates

    • Photoconvertible fluorescent proteins: Enable pulse-chase experiments in living cells to track newly synthesized versus existing UBC32

    • Bioluminescence Resonance Energy Transfer (BRET): Measures UBC32 interactions with minimal perturbation to living cells

  • Biosensors for Ubiquitination Activity:

    • FRET-based sensors: Develop sensors that undergo conformational changes upon ubiquitination, providing real-time visualization of UBC32 activity

    • Ubiquitin-based fluorescent reporters: Engineered substrates that change localization or fluorescence properties when ubiquitinated by UBC32

    • Single-molecule techniques: Track individual ubiquitination events in real time

  • Optogenetic Approaches:

    • Light-controlled activation: Engineer light-sensitive domains into UBC32 to control its activity with spatial and temporal precision

    • Optogenetic dimerization: Control UBC32 interactions with E3 ligases or substrates using light, allowing precise manipulation of the ERAD pathway

    • Targeted protein degradation: Deploy photo-sensitive degrons to rapidly modulate UBC32 levels in specific cellular compartments

  • Integrative Multi-omics:

    • Spatial proteomics: Map the precise distribution of UBC32 and its substrates across subcellular compartments

    • Temporal ubiquitinome analysis: Profile ubiquitination events over time following stress application

    • Single-cell approaches: Analyze UBC32 activity variations at the single-cell level to understand cell-to-cell heterogeneity

These emerging technologies will provide unprecedented insights into UBC32 dynamics and function in living cells under various physiological and stress conditions .

How does UBC32 function compare with other ubiquitin-conjugating enzymes in plants?

UBC32 exhibits several distinctive features when compared to other plant ubiquitin-conjugating enzymes:

  • Subcellular Localization:

    • UBC32 is localized to the ER membrane through its C-terminal transmembrane domain

    • This contrasts with many other E2s that are cytosolic or nuclear

    • This specialized localization enables UBC32 to function specifically in the ERAD pathway

  • Stress Responsiveness:

    • UBC32 gene expression is highly induced by multiple stressors (salt, drought, ER stress)

    • This differs from many constitutively expressed E2s

    • The stress-inducible nature suggests a specialized role in stress adaptation

  • Evolutionary Relationships:

    • UBC32 belongs to a distinct subfamily similar to the metazoan UBE2J1

    • UBC33 and UBC34 are related but belong to the UBE2J2 subfamily

    • This evolutionary divergence indicates specialized functions for these related E2s

  • Pathway Integration:

    • UBC32 uniquely bridges ERAD and brassinosteroid signaling pathways

    • This dual functionality distinguishes it from many other E2s with more limited pathway involvement

    • It represents a regulatory node connecting protein quality control with hormone signaling

  • Phenotypic Impact:

    • UBC32 manipulation results in clear stress tolerance phenotypes

    • Many other E2s show functional redundancy, with limited phenotypic effects when individually mutated

    • This suggests a more specialized, non-redundant role for UBC32

This comparative analysis reveals UBC32 as a specialized E2 enzyme with unique attributes that enable it to serve as an important regulator of stress responses and growth through its position at the intersection of ERAD and hormone signaling pathways .

What insights does UBC32 research provide about the evolution of ERAD pathways in plants?

UBC32 research offers significant insights into plant ERAD pathway evolution:

  • Conservation of Core ERAD Components:

    • UBC32 functions as a plant homolog of yeast Ubc6p and mammalian UBE2J1/UBE2J2

    • This conservation indicates that fundamental ERAD mechanisms arose early in eukaryotic evolution

    • Plant ERAD maintains the core ubiquitination machinery while adapting to plant-specific needs

  • Plant-Specific Adaptations:

    • UBC32's role in brassinosteroid signaling represents a plant-specific adaptation

    • This connection to hormone signaling may be unique to plants, reflecting their sessile lifestyle

    • It suggests evolutionary innovation in how plants integrated protein quality control with growth regulation

  • Specialized Stress Responses:

    • UBC32's high inducibility by salt and drought stress indicates adaptation to terrestrial environments

    • This stress responsiveness may represent an evolutionary innovation allowing plants to cope with variable environmental conditions

    • The connection between ERAD and abiotic stress appears particularly developed in plants

  • Expansion and Diversification:

    • Plants have expanded certain ERAD components, with UBC32, UBC33, and UBC34 potentially serving specialized roles

    • This diversification suggests functional specialization during plant evolution

    • Different plant E2s likely evolved to handle distinct aspects of protein quality control

  • Integration with Plant Signaling Networks:

    • Research shows UBC32 connects to ABA signaling (increased ABA insensitivity in ubc32 mutants)

    • This integration with plant-specific hormone pathways reflects evolutionary adaptation

    • It suggests that plants uniquely evolved to use ERAD as a regulatory mechanism for hormone responses

These evolutionary insights from UBC32 research highlight how plants have maintained conserved protein quality control mechanisms while adapting them to meet the unique challenges of a sessile lifestyle in variable environments .

What are the key unresolved questions about UBC32 function that future research should address?

Despite significant advances in understanding UBC32, several critical questions remain unresolved:

  • Substrate Specificity Determinants:

    • What features determine which proteins become UBC32 substrates?

    • Beyond BR receptors and MLO-12, what is the complete range of UBC32 substrates?

    • How does UBC32 discriminate between normal and misfolded proteins?

  • Regulatory Mechanisms:

    • How is UBC32 itself regulated post-translationally?

    • What factors determine UBC32 activity levels under different stress conditions?

    • Are there protein inhibitors or activators that modulate UBC32 function?

  • E3 Ligase Partners:

    • Beyond DOA10B, what is the complete set of E3 ligases that partner with UBC32?

    • How are these E2-E3 partnerships regulated under different conditions?

    • Do different E3 partners direct UBC32 to different substrates?

  • Cross-Talk with Other Pathways:

    • How exactly does UBC32 integrate signals from multiple stress response pathways?

    • What are the molecular mechanisms connecting UBC32 to ABA signaling?

    • Are there connections to other plant hormone pathways beyond brassinosteroids?

  • Species-Specific Functions:

    • How do the functions of UBC32 orthologs vary across plant species?

    • Are the connections to BR signaling and stress tolerance conserved in all plants?

    • What novel functions might UBC32 orthologs have acquired in specific plant lineages?

  • Spatial and Temporal Dynamics:

    • How does UBC32 activity vary across tissues and developmental stages?

    • What controls the high expression in roots and senescent leaves?

    • How rapidly does UBC32 activity respond to stress onset and recovery?

Addressing these questions will significantly advance our understanding of how UBC32 functions at the molecular level and how its activities are integrated into broader cellular responses to environmental challenges .

How might synthetic biology approaches be used to engineer novel UBC32 functions for biotechnological applications?

Synthetic biology offers exciting opportunities to engineer UBC32 for various applications:

  • Domain Swapping and Chimeric Proteins:

    • Create chimeric proteins combining UBC32's catalytic domain with alternative targeting domains

    • Redirect UBC32 activity to different cellular compartments by swapping the transmembrane domain

    • Engineer substrate recognition domains from other E2/E3 systems to create novel substrate specificity

  • Stress-Responsive Circuit Design:

    • Engineer synthetic promoters that fine-tune UBC32 expression in response to specific environmental cues

    • Create negative feedback loops to optimize stress responses

    • Develop positive feedforward loops that amplify beneficial stress responses while minimizing growth penalties

  • Engineered Substrate Specificity:

    • Modify UBC32's substrate binding interface to target specific proteins for degradation

    • Create variants that preferentially recognize and degrade proteins that limit crop productivity

    • Engineer orthogonal UBC32 variants that operate independently of endogenous systems

  • Biosensor Development:

    • Use UBC32's stress-responsive properties to develop plant biosensors for environmental monitoring

    • Create split reporter systems where UBC32 activity drives detectable outputs

    • Develop sensors that can detect subtle changes in ER stress levels

  • Conditional Protein Regulation Systems:

    • Engineer synthetic regulatory circuits where UBC32 activity is controlled by chemical or light inputs

    • Create systems for temporal control of protein degradation in specific plant tissues

    • Develop agricultural applications where UBC32 variants can be activated to enhance stress tolerance at critical growth stages

  • Enhanced Crop Protection:

    • Engineer UBC32 variants that specifically target pathogen proteins for degradation

    • Develop systems where pathogen detection triggers UBC32-mediated degradation of specific host susceptibility factors

    • Create UBC32-based systems that rapidly modify BR signaling in response to biotic stress

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.